PDB entry 5nbc

View 5nbc on RCSB PDB site
Description: Structure of Prokaryotic Transcription Factors
Class: DNA binding protein
Keywords: Virulence factor, DNA binding protein
Deposited on 2017-03-01, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferric uptake regulation protein
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Gene: fur, AV531_00680, DR86_1441
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nbca_
  • Chain 'B':
    Compound: ferric uptake regulation protein
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Gene: fur, AV531_00680, DR86_1441
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nbcb_
  • Chain 'C':
    Compound: ferric uptake regulation protein
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Gene: fur, AV531_00680, DR86_1441
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nbcc_
  • Chain 'D':
    Compound: ferric uptake regulation protein
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Gene: fur, AV531_00680, DR86_1441
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nbcd_
  • Heterogens: MN, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nbcA (A:)
    mnsknldlkefgfkvtqprveilklfeknkdkhlspddvfsklkaqgsttgiatvyrvln
    qfesagiinrlkldneqvmyelnqgehhdhiicvkcnmiqefyspgiealqkqivesfga
    emidyslniyvkckscreki
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nbcA (A:)
    lkefgfkvtqprveilklfeknkdkhlspddvfsklkaqgsttgiatvyrvlnqfesagi
    inrlkldneqvmyelnqgehhdhiicvkcnmiqefyspgiealqkqivesfgaemidysl
    niyvkckscre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nbcB (B:)
    mnsknldlkefgfkvtqprveilklfeknkdkhlspddvfsklkaqgsttgiatvyrvln
    qfesagiinrlkldneqvmyelnqgehhdhiicvkcnmiqefyspgiealqkqivesfga
    emidyslniyvkckscreki
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nbcB (B:)
    kefgfkvtqprveilklfeknkdkhlspddvfsklkaqgsttgiatvyrvlnqfesagii
    nrlkldneqvmyelnqgehhdhiicvkcnmiqefyspgiealqkqivesfgaemidysln
    iyvkckscre
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5nbcC (C:)
    mnsknldlkefgfkvtqprveilklfeknkdkhlspddvfsklkaqgsttgiatvyrvln
    qfesagiinrlkldneqvmyelnqgehhdhiicvkcnmiqefyspgiealqkqivesfga
    emidyslniyvkckscreki
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nbcC (C:)
    fkvtqprveilklfekkdkhlspddvfsklkaqgsttgiatvyrvlnqfesagiinrlkl
    dneqvmyelnqgehhdhiicvkcnmiqefyspgiealqkqivesfgaemidyslniyvkc
    kscre
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5nbcD (D:)
    mnsknldlkefgfkvtqprveilklfeknkdkhlspddvfsklkaqgsttgiatvyrvln
    qfesagiinrlkldneqvmyelnqgehhdhiicvkcnmiqefyspgiealqkqivesfga
    emidyslniyvkckscreki
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nbcD (D:)
    vtqprveilklfeknkdkhlspddvfsklkaqgsttgiatvyrvlnqfesagiinrlkld
    neqvmyelnqgehhdhiicvkcnmiqefyspgiealqkqivesfgaemidyslniyvkck
    scre