PDB entry 5nb1

View 5nb1 on RCSB PDB site
Description: Crystal structures of homooligomers of collagen type IV. alpha4NC1
Class: structural protein
Keywords: Non-collagenous domain of collagen type IV. A principal structural component of basement membranes, structural protein
Deposited on 2017-02-28, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 2.82 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Collagen alpha-4(IV) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL4A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nb1a1, d5nb1a2
  • Chain 'B':
    Compound: Collagen alpha-4(IV) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL4A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nb1b1, d5nb1b2
  • Chain 'C':
    Compound: Collagen alpha-4(IV) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL4A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nb1c1, d5nb1c2
  • Chain 'D':
    Compound: Collagen alpha-4(IV) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL4A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nb1d1, d5nb1d2
  • Chain 'E':
    Compound: Collagen alpha-4(IV) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL4A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nb1e1, d5nb1e2
  • Chain 'F':
    Compound: Collagen alpha-4(IV) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL4A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nb1f1, d5nb1f2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nb1A (A:)
    gylggfllvlhsqtdqeptcplgmprlwtgysllylegqekahnqdlglagsclpvfstl
    pfaycnihqvchyaqrndrsywlasaaplpmmplseeairpyvsrcavceapaqavavhs
    qdqsippcpqtwrslwigysflmhtgagdqgggqalmspgscledfraapflecqgrqgt
    chffankysfwlttvkadlqfssapapdtlkesqaqrqkisrcqvcvkys
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nb1A (A:)
    ggfllvlhsqtdqeptcplgmprlwtgysllylegqekahnqdlglagsclpvfstlpfa
    ycnihqvchyaqrndrsywlasaaplpmmplseeairpyvsrcavceapaqavavhsqdq
    sippcpqtwrslwigysflmhtgagdqgggqalmspgscledfraapflecqgrqgtchf
    fankysfwlttvesqaqrqkisrcqvcvky
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nb1B (B:)
    gylggfllvlhsqtdqeptcplgmprlwtgysllylegqekahnqdlglagsclpvfstl
    pfaycnihqvchyaqrndrsywlasaaplpmmplseeairpyvsrcavceapaqavavhs
    qdqsippcpqtwrslwigysflmhtgagdqgggqalmspgscledfraapflecqgrqgt
    chffankysfwlttvkadlqfssapapdtlkesqaqrqkisrcqvcvkys
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nb1B (B:)
    gfllvlhsqtdqeptcplgmprlwtgysllylegqekahnqdlglagsclpvfstlpfay
    cnihqvchyaqrndrsywlasaaplpmmplseeairpyvsrcavceapaqavavhsqdqs
    ippcpqtwrslwigysflmhtgagdqgggqalmspgscledfraapflecqgrqgtchff
    ankysfwlttvsqaqrqkisrcqvcvky
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5nb1C (C:)
    gylggfllvlhsqtdqeptcplgmprlwtgysllylegqekahnqdlglagsclpvfstl
    pfaycnihqvchyaqrndrsywlasaaplpmmplseeairpyvsrcavceapaqavavhs
    qdqsippcpqtwrslwigysflmhtgagdqgggqalmspgscledfraapflecqgrqgt
    chffankysfwlttvkadlqfssapapdtlkesqaqrqkisrcqvcvkys
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nb1C (C:)
    gfllvlhsqtdqeptcplgmprlwtgysllylegqekahnqdlglagsclpvfstlpfay
    cnihqvchyaqrndrsywlasaaplpmmplseeairpyvsrcavceapaqavavhsqdqs
    ippcpqtwrslwigysflmhtgagdqgggqalmspgscledfraapflecqgrqgtchff
    ankysfwlttvsqaqrqkisrcqvcvky
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5nb1D (D:)
    gylggfllvlhsqtdqeptcplgmprlwtgysllylegqekahnqdlglagsclpvfstl
    pfaycnihqvchyaqrndrsywlasaaplpmmplseeairpyvsrcavceapaqavavhs
    qdqsippcpqtwrslwigysflmhtgagdqgggqalmspgscledfraapflecqgrqgt
    chffankysfwlttvkadlqfssapapdtlkesqaqrqkisrcqvcvkys
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nb1D (D:)
    gfllvlhsqtdqeptcplgmprlwtgysllylegqekahnqdlglagsclpvfstlpfay
    cnihqvchyaqrndrsywlasaaplpmmplseeairpyvsrcavceapaqavavhsqdqs
    ippcpqtwrslwigysflmhtgagdqgggqalmspgscledfraapflecqgrqgtchff
    ankysfwlttvsqaqrqkisrcqvcvky
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5nb1E (E:)
    gylggfllvlhsqtdqeptcplgmprlwtgysllylegqekahnqdlglagsclpvfstl
    pfaycnihqvchyaqrndrsywlasaaplpmmplseeairpyvsrcavceapaqavavhs
    qdqsippcpqtwrslwigysflmhtgagdqgggqalmspgscledfraapflecqgrqgt
    chffankysfwlttvkadlqfssapapdtlkesqaqrqkisrcqvcvkys
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nb1E (E:)
    fllvlhsqtdqeptcplgmprlwtgysllylegqekahnqdlglagsclpvfstlpfayc
    nihqvchyaqrndrsywlasaaplpmmplseeairpyvsrcavceapaqavavhsqdqsi
    ppcpqtwrslwigysflmhtgagdqgggqalmspgscledfraapflecqgrqgtchffa
    nkysfwlttvqaqrqkisrcqvcvky
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5nb1F (F:)
    gylggfllvlhsqtdqeptcplgmprlwtgysllylegqekahnqdlglagsclpvfstl
    pfaycnihqvchyaqrndrsywlasaaplpmmplseeairpyvsrcavceapaqavavhs
    qdqsippcpqtwrslwigysflmhtgagdqgggqalmspgscledfraapflecqgrqgt
    chffankysfwlttvkadlqfssapapdtlkesqaqrqkisrcqvcvkys
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nb1F (F:)
    gfllvlhsqtdqeptcplgmprlwtgysllylegqekahnqdlglagsclpvfstlpfay
    cnihqvchyaqrndrsywlasaaplpmmplseeairpyvsrcavceapaqavavhsqdqs
    ippcpqtwrslwigysflmhtgagdqgggqalmspgscledfraapflecqgrqgtchff
    ankysfwlttvqaqrqkisrcqvcvky