PDB entry 5nb0

View 5nb0 on RCSB PDB site
Description: Crystal structures of homooligomers of collagen type IV. alpha3NC1
Class: structural protein
Keywords: Non-collagenous domain of collagen type IV. A principal structural component of basement membranes, STRUCTURAL PROTEIN
Deposited on 2017-02-28, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Collagen alpha-3(IV) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL4A3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nb0a1, d5nb0a2
  • Chain 'B':
    Compound: Collagen alpha-3(IV) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL4A3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nb0b1, d5nb0b2
  • Chain 'C':
    Compound: Collagen alpha-3(IV) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL4A3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nb0c1, d5nb0c2
  • Chain 'D':
    Compound: Collagen alpha-3(IV) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL4A3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nb0d1, d5nb0d2
  • Chain 'E':
    Compound: Collagen alpha-3(IV) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL4A3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nb0e1, d5nb0e2
  • Chain 'F':
    Compound: Collagen alpha-3(IV) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL4A3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nb0f1, d5nb0f2
  • Chain 'G':
    Compound: Collagen alpha-3(IV) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL4A3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nb0g1, d5nb0g2
  • Chain 'H':
    Compound: Collagen alpha-3(IV) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL4A3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nb0h1, d5nb0h2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nb0A (A:)
    wttrgfvftrhsqttaipscpegtvplysgfsflfvqgnqrahgqdlgtlgsclqrfttm
    pflfcnvndvcnfasrndysywlstpalmpmnmapitgralepyisrctvcegpaiaiav
    hsqttdippcphgwislwkgfsfimftsagsegtgqalaspgscleefraspflechgrg
    tcnyysnsysfwlaslnpermfrkpipstvkagelekiisrcqvcmkkrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nb0A (A:)
    rgfvftrhsqttaipscpegtvplysgfsflfvqgnqrahgqdlgtlgsclqrfttmpfl
    fcnvndvcnfasrndysywlstpalmpmnmapitgralepyisrctvcegpaiaiavhsq
    ttdippcphgwislwkgfsfimftsagsegtgqalaspgscleefraspflechgrgtcn
    yysnsysfwlaslnpermfrkpipstvkagelekiisrcqvcmkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nb0B (B:)
    wttrgfvftrhsqttaipscpegtvplysgfsflfvqgnqrahgqdlgtlgsclqrfttm
    pflfcnvndvcnfasrndysywlstpalmpmnmapitgralepyisrctvcegpaiaiav
    hsqttdippcphgwislwkgfsfimftsagsegtgqalaspgscleefraspflechgrg
    tcnyysnsysfwlaslnpermfrkpipstvkagelekiisrcqvcmkkrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nb0B (B:)
    trgfvftrhsqttaipscpegtvplysgfsflfvqgnqrahgqdlgtlgsclqrfttmpf
    lfcnvndvcnfasrndysywlstpalmpmnmapitgralepyisrctvcegpaiaiavhs
    qttdippcphgwislwkgfsfimftsagsegtgqalaspgscleefraspflechgrgtc
    nyysnsysfwlaslnpermfrkpipstvkagelekiisrcqvcmkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5nb0C (C:)
    wttrgfvftrhsqttaipscpegtvplysgfsflfvqgnqrahgqdlgtlgsclqrfttm
    pflfcnvndvcnfasrndysywlstpalmpmnmapitgralepyisrctvcegpaiaiav
    hsqttdippcphgwislwkgfsfimftsagsegtgqalaspgscleefraspflechgrg
    tcnyysnsysfwlaslnpermfrkpipstvkagelekiisrcqvcmkkrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nb0C (C:)
    rgfvftrhsqttaipscpegtvplysgfsflfvqgnqrahgqdlgtlgsclqrfttmpfl
    fcnvndvcnfasrndysywlstpalmpmnmapitgralepyisrctvcegpaiaiavhsq
    ttdippcphgwislwkgfsfimftsagsegtgqalaspgscleefraspflechgrgtcn
    yysnsysfwlaslnpermfrkpipstvkagelekiisrcqvcmkk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5nb0D (D:)
    wttrgfvftrhsqttaipscpegtvplysgfsflfvqgnqrahgqdlgtlgsclqrfttm
    pflfcnvndvcnfasrndysywlstpalmpmnmapitgralepyisrctvcegpaiaiav
    hsqttdippcphgwislwkgfsfimftsagsegtgqalaspgscleefraspflechgrg
    tcnyysnsysfwlaslnpermfrkpipstvkagelekiisrcqvcmkkrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nb0D (D:)
    ttrgfvftrhsqttaipscpegtvplysgfsflfvqgnqrahgqdlgtlgsclqrfttmp
    flfcnvndvcnfasrndysywlstpalmpmnmapitgralepyisrctvcegpaiaiavh
    sqttdippcphgwislwkgfsfimftsagsegtgqalaspgscleefraspflechgrgt
    cnyysnsysfwlaslnpermfrkpipstvkagelekiisrcqvcmkk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5nb0E (E:)
    wttrgfvftrhsqttaipscpegtvplysgfsflfvqgnqrahgqdlgtlgsclqrfttm
    pflfcnvndvcnfasrndysywlstpalmpmnmapitgralepyisrctvcegpaiaiav
    hsqttdippcphgwislwkgfsfimftsagsegtgqalaspgscleefraspflechgrg
    tcnyysnsysfwlaslnpermfrkpipstvkagelekiisrcqvcmkkrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nb0E (E:)
    rgfvftrhsqttaipscpegtvplysgfsflfvqgnqrahgqdlgtlgsclqrfttmpfl
    fcnvndvcnfasrndysywlstpalmpmnmapitgralepyisrctvcegpaiaiavhsq
    ttdippcphgwislwkgfsfimftsagsegtgqalaspgscleefraspflechgrgtcn
    yysnsysfwlaslnpermfrkpipstvkagelekiisrcqvcmkk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5nb0F (F:)
    wttrgfvftrhsqttaipscpegtvplysgfsflfvqgnqrahgqdlgtlgsclqrfttm
    pflfcnvndvcnfasrndysywlstpalmpmnmapitgralepyisrctvcegpaiaiav
    hsqttdippcphgwislwkgfsfimftsagsegtgqalaspgscleefraspflechgrg
    tcnyysnsysfwlaslnpermfrkpipstvkagelekiisrcqvcmkkrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nb0F (F:)
    trgfvftrhsqttaipscpegtvplysgfsflfvqgnqrahgqdlgtlgsclqrfttmpf
    lfcnvndvcnfasrndysywlstpalmpmnmapitgralepyisrctvcegpaiaiavhs
    qttdippcphgwislwkgfsfimftsagsegtgqalaspgscleefraspflechgrgtc
    nyysnsysfwlaslnpermfrkpipstvkagelekiisrcqvcmkk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5nb0G (G:)
    wttrgfvftrhsqttaipscpegtvplysgfsflfvqgnqrahgqdlgtlgsclqrfttm
    pflfcnvndvcnfasrndysywlstpalmpmnmapitgralepyisrctvcegpaiaiav
    hsqttdippcphgwislwkgfsfimftsagsegtgqalaspgscleefraspflechgrg
    tcnyysnsysfwlaslnpermfrkpipstvkagelekiisrcqvcmkkrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nb0G (G:)
    rgfvftrhsqttaipscpegtvplysgfsflfvqgnqrahgqdlgtlgsclqrfttmpfl
    fcnvndvcnfasrndysywlstpalmpmnmapitgralepyisrctvcegpaiaiavhsq
    ttdippcphgwislwkgfsfimftsagsegtgqalaspgscleefraspflechgrgtcn
    yysnsysfwlaslnpermfrkpipstvkagelekiisrcqvcmkk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5nb0H (H:)
    wttrgfvftrhsqttaipscpegtvplysgfsflfvqgnqrahgqdlgtlgsclqrfttm
    pflfcnvndvcnfasrndysywlstpalmpmnmapitgralepyisrctvcegpaiaiav
    hsqttdippcphgwislwkgfsfimftsagsegtgqalaspgscleefraspflechgrg
    tcnyysnsysfwlaslnpermfrkpipstvkagelekiisrcqvcmkkrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nb0H (H:)
    rgfvftrhsqttaipscpegtvplysgfsflfvqgnqrahgqdlgtlgsclqrfttmpfl
    fcnvndvcnfasrndysywlstpalmpmnmapitgralepyisrctvcegpaiaiavhsq
    ttdippcphgwislwkgfsfimftsagsegtgqalaspgscleefraspflechgrgtcn
    yysnsysfwlaslnpermfrkpipstvkagelekiisrcqvcmkk