PDB entry 5naz

View 5naz on RCSB PDB site
Description: Crystal structures of homooligomers of collagen type IV. alpha5NC1
Class: structural protein
Keywords: Non-collagenous domain of collagen type IV. A principal structural component of basement membranes, structural protein
Deposited on 2017-02-28, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Collagen alpha-5(IV) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL4A5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5naza1, d5naza2
  • Heterogens: CL, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nazA (A:)
    svahgflitrhsqttdapqcpqgtlqvyegfsllyvqgnkrahgqdlgtagsclrrfstm
    pfmfcninnvcnfasrndysywlstpepmpmsmqplkgqsiqpfisrcavceapavviav
    hsqtiqiphcpqgwdslwigysfmmhtsagaegsgqalaspgscleefrsapfiechgrg
    tcnyyansysfwlatvdvsdmfskpqsetlkagdlrtrisrcqvcmkrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nazA (A:)
    hgflitrhsqttdapqcpqgtlqvyegfsllyvqgnkrahgqdlgtagsclrrfstmpfm
    fcninnvcnfasrndysywlstpepmpmsmqplkgqsiqpfisrcavceapavviavhsq
    tiqiphcpqgwdslwigysfmmhtsagaegsgqalaspgscleefrsapfiechgrgtcn
    yyansysfwlatvdvsdmfskpqsetlkagdlrtrisrcqvcmkrt