PDB entry 5nay

View 5nay on RCSB PDB site
Description: Crystal structures of homooligomers of collagen type IV. alpha1NC1
Class: structural protein
Keywords: Non-collagenous domain of collagen type IV. A principal structural component of basement membranes, STRUCTURAL PROTEIN
Deposited on 2017-02-28, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Collagen alpha-1(IV) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL4A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5naya1, d5naya2
  • Chain 'B':
    Compound: Collagen alpha-1(IV) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL4A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nayb1, d5nayb2
  • Chain 'C':
    Compound: Collagen alpha-1(IV) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL4A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nayc1, d5nayc2
  • Chain 'D':
    Compound: Collagen alpha-1(IV) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL4A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nayd1, d5nayd2
  • Chain 'E':
    Compound: Collagen alpha-1(IV) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL4A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5naye1, d5naye2
  • Chain 'F':
    Compound: Collagen alpha-1(IV) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL4A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nayf1, d5nayf2
  • Heterogens: CL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nayA (A:)
    svdhgflvtrhsqtiddpqcpsgtkilyhgysllyvqgnerahgqdlgtagsclrkfstm
    pflfcninnvcnfasrndysywlstpepmpmsmapitgenirpfisrcavceapamvmav
    hsqtiqippcpsgwsslwigysfvmhtsagaegsgqalaspgscleefrsapfiechgrg
    tcnyyanaysfwlatiersemfkkptpstlkagelrthvsrcqvcmrrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nayA (A:)
    vdhgflvtrhsqtiddpqcpsgtkilyhgysllyvqgnerahgqdlgtagsclrkfstmp
    flfcninnvcnfasrndysywlstpepmpmsmapitgenirpfisrcavceapamvmavh
    sqtiqippcpsgwsslwigysfvmhtsagaegsgqalaspgscleefrsapfiechgrgt
    cnyyanaysfwlatiersemfkkptpstlkagelrthvsrcqvcmrrt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nayB (B:)
    svdhgflvtrhsqtiddpqcpsgtkilyhgysllyvqgnerahgqdlgtagsclrkfstm
    pflfcninnvcnfasrndysywlstpepmpmsmapitgenirpfisrcavceapamvmav
    hsqtiqippcpsgwsslwigysfvmhtsagaegsgqalaspgscleefrsapfiechgrg
    tcnyyanaysfwlatiersemfkkptpstlkagelrthvsrcqvcmrrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nayB (B:)
    vdhgflvtrhsqtiddpqcpsgtkilyhgysllyvqgnerahgqdlgtagsclrkfstmp
    flfcninnvcnfasrndysywlstpepmpmsmapitgenirpfisrcavceapamvmavh
    sqtiqippcpsgwsslwigysfvmhtsagaegsgqalaspgscleefrsapfiechgrgt
    cnyyanaysfwlatiersemfkkptpstlkagelrthvsrcqvcmrrt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5nayC (C:)
    svdhgflvtrhsqtiddpqcpsgtkilyhgysllyvqgnerahgqdlgtagsclrkfstm
    pflfcninnvcnfasrndysywlstpepmpmsmapitgenirpfisrcavceapamvmav
    hsqtiqippcpsgwsslwigysfvmhtsagaegsgqalaspgscleefrsapfiechgrg
    tcnyyanaysfwlatiersemfkkptpstlkagelrthvsrcqvcmrrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nayC (C:)
    vdhgflvtrhsqtiddpqcpsgtkilyhgysllyvqgnerahgqdlgtagsclrkfstmp
    flfcninnvcnfasrndysywlstpepmpmsmapitgenirpfisrcavceapamvmavh
    sqtiqippcpsgwsslwigysfvmhtsagaegsgqalaspgscleefrsapfiechgrgt
    cnyyanaysfwlatiersemfkkptpstlkagelrthvsrcqvcmrrt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5nayD (D:)
    svdhgflvtrhsqtiddpqcpsgtkilyhgysllyvqgnerahgqdlgtagsclrkfstm
    pflfcninnvcnfasrndysywlstpepmpmsmapitgenirpfisrcavceapamvmav
    hsqtiqippcpsgwsslwigysfvmhtsagaegsgqalaspgscleefrsapfiechgrg
    tcnyyanaysfwlatiersemfkkptpstlkagelrthvsrcqvcmrrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nayD (D:)
    vdhgflvtrhsqtiddpqcpsgtkilyhgysllyvqgnerahgqdlgtagsclrkfstmp
    flfcninnvcnfasrndysywlstpepmpmsmapitgenirpfisrcavceapamvmavh
    sqtiqippcpsgwsslwigysfvmhtsagaegsgqalaspgscleefrsapfiechgrgt
    cnyyanaysfwlatiersemfkkptpstlkagelrthvsrcqvcmrrt
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5nayE (E:)
    svdhgflvtrhsqtiddpqcpsgtkilyhgysllyvqgnerahgqdlgtagsclrkfstm
    pflfcninnvcnfasrndysywlstpepmpmsmapitgenirpfisrcavceapamvmav
    hsqtiqippcpsgwsslwigysfvmhtsagaegsgqalaspgscleefrsapfiechgrg
    tcnyyanaysfwlatiersemfkkptpstlkagelrthvsrcqvcmrrt
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5nayF (F:)
    svdhgflvtrhsqtiddpqcpsgtkilyhgysllyvqgnerahgqdlgtagsclrkfstm
    pflfcninnvcnfasrndysywlstpepmpmsmapitgenirpfisrcavceapamvmav
    hsqtiqippcpsgwsslwigysfvmhtsagaegsgqalaspgscleefrsapfiechgrg
    tcnyyanaysfwlatiersemfkkptpstlkagelrthvsrcqvcmrrt