PDB entry 5nax

View 5nax on RCSB PDB site
Description: Crystal structures of homooligomers of the non-collagenous domains of collagen type IV. alpha121NC1
Class: structural protein
Keywords: Non-collagenous domain of collagen type IV, A principal structural component of basement membranes, structural protein
Deposited on 2017-02-28, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 2.82 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Collagen alpha-1(IV) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL4A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5naxa1, d5naxa2
  • Chain 'B':
    Compound: Collagen alpha-1(IV) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL4A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5naxb1, d5naxb2
  • Chain 'C':
    Compound: Collagen alpha-2(IV) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL4A2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5naxc1, d5naxc2
  • Chain 'D':
    Compound: Collagen alpha-1(IV) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL4A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5naxd1, d5naxd2
  • Chain 'E':
    Compound: Collagen alpha-2(IV) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL4A2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5naxe1, d5naxe2
  • Chain 'F':
    Compound: Collagen alpha-1(IV) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL4A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5naxf1, d5naxf2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5naxA (A:)
    svdhgflvtrhsqtiddpqcpsgtkilyhgysllyvqgnerahgqdlgtagsclrkfstm
    pflfcninnvcnfasrndysywlstpepmpmsmapitgenirpfisrcavceapamvmav
    hsqtiqippcpsgwsslwigysfvmhtsagaegsgqalaspgscleefrsapfiechgrg
    tcnyyanaysfwlatiersemfkkptpstlkagelrthvsrcqvcmrrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5naxA (A:)
    dhgflvtrhsqtiddpqcpsgtkilyhgysllyvqgnerahgqdlgtagsclrkfstmpf
    lfcninnvcnfasrndysywlstpepmpmsmapitgenirpfisrcavceapamvmavhs
    qtiqippcpsgwsslwigysfvmhtsagaegsgqalaspgscleefrsapfiechgrgtc
    nyyanaysfwlatiersemfkkptpstlkagelrthvsrcqvcmrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5naxB (B:)
    svdhgflvtrhsqtiddpqcpsgtkilyhgysllyvqgnerahgqdlgtagsclrkfstm
    pflfcninnvcnfasrndysywlstpepmpmsmapitgenirpfisrcavceapamvmav
    hsqtiqippcpsgwsslwigysfvmhtsagaegsgqalaspgscleefrsapfiechgrg
    tcnyyanaysfwlatiersemfkkptpstlkagelrthvsrcqvcmrrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5naxB (B:)
    dhgflvtrhsqtiddpqcpsgtkilyhgysllyvqgnerahgqdlgtagsclrkfstmpf
    lfcninnvcnfasrndysywlstpepmpmsmapitgenirpfisrcavceapamvmavhs
    qtiqippcpsgwsslwigysfvmhtsagaegsgqalaspgscleefrsapfiechgrgtc
    nyyanaysfwlatiersemfkkptpstlkagelrthvsrcqvcmrrt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5naxC (C:)
    svsigyllvkhsqtdqepmcpvgmnklwsgysllyfegqekahnqdlglagsclarfstm
    pflycnpgdvcyyasrndksywlsttaplpmmpvaedeikpyisrcsvceapaiaiavhs
    qdvsiphcpagwrslwigysflmhtaagdegggqslvspgscledfratpfiecnggrgt
    chyyankysfwlttipeqsfqgspsadtlkaglirthisrcqvcmknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5naxC (C:)
    gyllvkhsqtdqepmcpvgmnklwsgysllyfegqekahnqdlglagsclarfstmpfly
    cnpgdvcyyasrndksywlsttaplpmmpvaedeikpyisrcsvceapaiaiavhsqdvs
    iphcpagwrslwigysflmhtaagdegggqslvspgscledfratpfiecnggrgtchyy
    ankysfwlttipeqsfqgspsadtlkaglirthisrcqvcmknl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5naxD (D:)
    svdhgflvtrhsqtiddpqcpsgtkilyhgysllyvqgnerahgqdlgtagsclrkfstm
    pflfcninnvcnfasrndysywlstpepmpmsmapitgenirpfisrcavceapamvmav
    hsqtiqippcpsgwsslwigysfvmhtsagaegsgqalaspgscleefrsapfiechgrg
    tcnyyanaysfwlatiersemfkkptpstlkagelrthvsrcqvcmrrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5naxD (D:)
    hgflvtrhsqtiddpqcpsgtkilyhgysllyvqgnerahgqdlgtagsclrkfstmpfl
    fcninnvcnfasrndysywlstpepmpmsmapitgenirpfisrcavceapamvmavhsq
    tiqippcpsgwsslwigysfvmhtsagaegsgqalaspgscleefrsapfiechgrgtcn
    yyanaysfwlatiersemfkkptpstlkagelrthvsrcqvcmrr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5naxE (E:)
    svsigyllvkhsqtdqepmcpvgmnklwsgysllyfegqekahnqdlglagsclarfstm
    pflycnpgdvcyyasrndksywlsttaplpmmpvaedeikpyisrcsvceapaiaiavhs
    qdvsiphcpagwrslwigysflmhtaagdegggqslvspgscledfratpfiecnggrgt
    chyyankysfwlttipeqsfqgspsadtlkaglirthisrcqvcmknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5naxE (E:)
    igyllvkhsqtdqepmcpvgmnklwsgysllyfegqekahnqdlglagsclarfstmpfl
    ycnpgdvcyyasrndksywlsttaplpmmpvaedeikpyisrcsvceapaiaiavhsqdv
    siphcpagwrslwigysflmhtaagdegggqslvspgscledfratpfiecnggrgtchy
    yankysfwlttipeqsfqgspsadtlkaglirthisrcqvcmk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5naxF (F:)
    svdhgflvtrhsqtiddpqcpsgtkilyhgysllyvqgnerahgqdlgtagsclrkfstm
    pflfcninnvcnfasrndysywlstpepmpmsmapitgenirpfisrcavceapamvmav
    hsqtiqippcpsgwsslwigysfvmhtsagaegsgqalaspgscleefrsapfiechgrg
    tcnyyanaysfwlatiersemfkkptpstlkagelrthvsrcqvcmrrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5naxF (F:)
    gflvtrhsqtiddpqcpsgtkilyhgysllyvqgnerahgqdlgtagsclrkfstmpflf
    cninnvcnfasrndysywlstpepmpmsmapitgenirpfisrcavceapamvmavhsqt
    iqippcpsgwsslwigysfvmhtsagaegsgqalaspgscleefrsapfiechgrgtcny
    yanaysfwlatiersemfkkptpstlkagelrthvsrcqvcmr