PDB entry 5nav

View 5nav on RCSB PDB site
Description: Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum
Class: hydrolase
Keywords: cysteine residue, glycosides, protein aggregation, reducing agent, solubility enhancer, hydrolase
Deposited on 2017-02-28, released 2017-08-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-galactosidase
    Species: Lactobacillus plantarum [TaxId:1590]
    Gene: bgl, lp_3629
    Database cross-references and differences (RAF-indexed):
    • Uniprot F9ULH8 (16-476)
      • engineered mutation (226)
      • engineered mutation (307)
    Domains in SCOPe 2.06: d5nava_
  • Chain 'B':
    Compound: beta-galactosidase
    Species: Lactobacillus plantarum [TaxId:1590]
    Gene: bgl, lp_3629
    Database cross-references and differences (RAF-indexed):
    • Uniprot F9ULH8 (16-476)
      • engineered mutation (226)
      • engineered mutation (307)
    Domains in SCOPe 2.06: d5navb_
  • Chain 'C':
    Compound: beta-galactosidase
    Species: Lactobacillus plantarum [TaxId:1590]
    Gene: bgl, lp_3629
    Database cross-references and differences (RAF-indexed):
    • Uniprot F9ULH8 (16-476)
      • engineered mutation (226)
      • engineered mutation (307)
    Domains in SCOPe 2.06: d5navc_
  • Chain 'D':
    Compound: beta-galactosidase
    Species: Lactobacillus plantarum [TaxId:1590]
    Gene: bgl, lp_3629
    Database cross-references and differences (RAF-indexed):
    • Uniprot F9ULH8 (16-476)
      • engineered mutation (226)
      • engineered mutation (307)
    Domains in SCOPe 2.06: d5navd_
  • Chain 'E':
    Compound: beta-galactosidase
    Species: Lactobacillus plantarum [TaxId:1590]
    Gene: bgl, lp_3629
    Database cross-references and differences (RAF-indexed):
    • Uniprot F9ULH8 (16-476)
      • engineered mutation (226)
      • engineered mutation (307)
    Domains in SCOPe 2.06: d5nave_
  • Chain 'F':
    Compound: beta-galactosidase
    Species: Lactobacillus plantarum [TaxId:1590]
    Gene: bgl, lp_3629
    Database cross-references and differences (RAF-indexed):
    • Uniprot F9ULH8 (16-476)
      • engineered mutation (226)
      • engineered mutation (307)
    Domains in SCOPe 2.06: d5navf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5navA (A:)
    mggshhhhhhgddddkmvefpegfvwgaatsgpqtegnfhkqhqnvfdywfatepeqfda
    gvgpdtasnfyndydhdlalmaqagvqglrtsiqwtrliddfetaslnadgvafynhvid
    smlahhitpyinlhhfdlpvalydkyhgweskhvvelfvkfaeqcfklfgdrvdhwytfn
    epkvvvdgqylygwhypqvingpkavqvaynmnlasaktvarfhelsvrpeqqigiilnl
    tpayaasddpadlaaaefaelwsnnlfldpavlghfpeklverltmdgvlwdatptelai
    iaanpvdslgvnyyhpfrvqrpdispkslqpwmpdiyfkeydmpgrmmnvdrgweiypqa
    mtdiarniqknygnipwmisengmgvageerfldkqgvvqddyridfmkehltalakgia
    agsncqgyfvwsgidcwswnhayhnryglirndihtqtktlkksakwfaelgerngf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5navA (A:)
    mvefpegfvwgaatsgpqtegnfhkqhqnvfdywfatepeqfdagvgpdtasnfyndydh
    dlalmaqagvqglrtsiqwtrliddfetaslnadgvafynhvidsmlahhitpyinlhhf
    dlpvalydkyhgweskhvvelfvkfaeqcfklfgdrvdhwytfnepkvvvdgqylygwhy
    pqvingpkavqvaynmnlasaktvarfhelsvrpeqqigiilnltpayaasddpadlaaa
    efaelwsnnlfldpavlghfpeklverltmdgvlwdatptelaiiaanpvdslgvnyyhp
    frvqrpdispkslqpwmpdiyfkeydmpgrmmnvdrgweiypqamtdiarniqknygnip
    wmisengmgvageerfldkqgvvqddyridfmkehltalakgiaagsncqgyfvwsgidc
    wswnhayhnryglirndihtqtktlkksakwfaelgerngf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5navB (B:)
    mggshhhhhhgddddkmvefpegfvwgaatsgpqtegnfhkqhqnvfdywfatepeqfda
    gvgpdtasnfyndydhdlalmaqagvqglrtsiqwtrliddfetaslnadgvafynhvid
    smlahhitpyinlhhfdlpvalydkyhgweskhvvelfvkfaeqcfklfgdrvdhwytfn
    epkvvvdgqylygwhypqvingpkavqvaynmnlasaktvarfhelsvrpeqqigiilnl
    tpayaasddpadlaaaefaelwsnnlfldpavlghfpeklverltmdgvlwdatptelai
    iaanpvdslgvnyyhpfrvqrpdispkslqpwmpdiyfkeydmpgrmmnvdrgweiypqa
    mtdiarniqknygnipwmisengmgvageerfldkqgvvqddyridfmkehltalakgia
    agsncqgyfvwsgidcwswnhayhnryglirndihtqtktlkksakwfaelgerngf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5navB (B:)
    mvefpegfvwgaatsgpqtegnfhkqhqnvfdywfatepeqfdagvgpdtasnfyndydh
    dlalmaqagvqglrtsiqwtrliddfetaslnadgvafynhvidsmlahhitpyinlhhf
    dlpvalydkyhgweskhvvelfvkfaeqcfklfgdrvdhwytfnepkvvvdgqylygwhy
    pqvingpkavqvaynmnlasaktvarfhelsvrpeqqigiilnltpayaasddpadlaaa
    efaelwsnnlfldpavlghfpeklverltmdgvlwdatptelaiiaanpvdslgvnyyhp
    frvqrpdispkslqpwmpdiyfkeydmpgrmmnvdrgweiypqamtdiarniqknygnip
    wmisengmgvageerfldkqgvvqddyridfmkehltalakgiaagsncqgyfvwsgidc
    wswnhayhnryglirndihtqtktlkksakwfaelgerngf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5navC (C:)
    mggshhhhhhgddddkmvefpegfvwgaatsgpqtegnfhkqhqnvfdywfatepeqfda
    gvgpdtasnfyndydhdlalmaqagvqglrtsiqwtrliddfetaslnadgvafynhvid
    smlahhitpyinlhhfdlpvalydkyhgweskhvvelfvkfaeqcfklfgdrvdhwytfn
    epkvvvdgqylygwhypqvingpkavqvaynmnlasaktvarfhelsvrpeqqigiilnl
    tpayaasddpadlaaaefaelwsnnlfldpavlghfpeklverltmdgvlwdatptelai
    iaanpvdslgvnyyhpfrvqrpdispkslqpwmpdiyfkeydmpgrmmnvdrgweiypqa
    mtdiarniqknygnipwmisengmgvageerfldkqgvvqddyridfmkehltalakgia
    agsncqgyfvwsgidcwswnhayhnryglirndihtqtktlkksakwfaelgerngf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5navC (C:)
    mvefpegfvwgaatsgpqtegnfhkqhqnvfdywfatepeqfdagvgpdtasnfyndydh
    dlalmaqagvqglrtsiqwtrliddfetaslnadgvafynhvidsmlahhitpyinlhhf
    dlpvalydkyhgweskhvvelfvkfaeqcfklfgdrvdhwytfnepkvvvdgqylygwhy
    pqvingpkavqvaynmnlasaktvarfhelsvrpeqqigiilnltpayaasddpadlaaa
    efaelwsnnlfldpavlghfpeklverltmdgvlwdatptelaiiaanpvdslgvnyyhp
    frvqrpdispkslqpwmpdiyfkeydmpgrmmnvdrgweiypqamtdiarniqknygnip
    wmisengmgvageerfldkqgvvqddyridfmkehltalakgiaagsncqgyfvwsgidc
    wswnhayhnryglirndihtqtktlkksakwfaelgerngf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5navD (D:)
    mggshhhhhhgddddkmvefpegfvwgaatsgpqtegnfhkqhqnvfdywfatepeqfda
    gvgpdtasnfyndydhdlalmaqagvqglrtsiqwtrliddfetaslnadgvafynhvid
    smlahhitpyinlhhfdlpvalydkyhgweskhvvelfvkfaeqcfklfgdrvdhwytfn
    epkvvvdgqylygwhypqvingpkavqvaynmnlasaktvarfhelsvrpeqqigiilnl
    tpayaasddpadlaaaefaelwsnnlfldpavlghfpeklverltmdgvlwdatptelai
    iaanpvdslgvnyyhpfrvqrpdispkslqpwmpdiyfkeydmpgrmmnvdrgweiypqa
    mtdiarniqknygnipwmisengmgvageerfldkqgvvqddyridfmkehltalakgia
    agsncqgyfvwsgidcwswnhayhnryglirndihtqtktlkksakwfaelgerngf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5navD (D:)
    mvefpegfvwgaatsgpqtegnfhkqhqnvfdywfatepeqfdagvgpdtasnfyndydh
    dlalmaqagvqglrtsiqwtrliddfetaslnadgvafynhvidsmlahhitpyinlhhf
    dlpvalydkyhgweskhvvelfvkfaeqcfklfgdrvdhwytfnepkvvvdgqylygwhy
    pqvingpkavqvaynmnlasaktvarfhelsvrpeqqigiilnltpayaasddpadlaaa
    efaelwsnnlfldpavlghfpeklverltmdgvlwdatptelaiiaanpvdslgvnyyhp
    frvqrpdispkslqpwmpdiyfkeydmpgrmmnvdrgweiypqamtdiarniqknygnip
    wmisengmgvageerfldkqgvvqddyridfmkehltalakgiaagsncqgyfvwsgidc
    wswnhayhnryglirndihtqtktlkksakwfaelgerngf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5navE (E:)
    mggshhhhhhgddddkmvefpegfvwgaatsgpqtegnfhkqhqnvfdywfatepeqfda
    gvgpdtasnfyndydhdlalmaqagvqglrtsiqwtrliddfetaslnadgvafynhvid
    smlahhitpyinlhhfdlpvalydkyhgweskhvvelfvkfaeqcfklfgdrvdhwytfn
    epkvvvdgqylygwhypqvingpkavqvaynmnlasaktvarfhelsvrpeqqigiilnl
    tpayaasddpadlaaaefaelwsnnlfldpavlghfpeklverltmdgvlwdatptelai
    iaanpvdslgvnyyhpfrvqrpdispkslqpwmpdiyfkeydmpgrmmnvdrgweiypqa
    mtdiarniqknygnipwmisengmgvageerfldkqgvvqddyridfmkehltalakgia
    agsncqgyfvwsgidcwswnhayhnryglirndihtqtktlkksakwfaelgerngf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5navE (E:)
    mvefpegfvwgaatsgpqtegnfhkqhqnvfdywfatepeqfdagvgpdtasnfyndydh
    dlalmaqagvqglrtsiqwtrliddfetaslnadgvafynhvidsmlahhitpyinlhhf
    dlpvalydkyhgweskhvvelfvkfaeqcfklfgdrvdhwytfnepkvvvdgqylygwhy
    pqvingpkavqvaynmnlasaktvarfhelsvrpeqqigiilnltpayaasddpadlaaa
    efaelwsnnlfldpavlghfpeklverltmdgvlwdatptelaiiaanpvdslgvnyyhp
    frvqrpdispkslqpwmpdiyfkeydmpgrmmnvdrgweiypqamtdiarniqknygnip
    wmisengmgvageerfldkqgvvqddyridfmkehltalakgiaagsncqgyfvwsgidc
    wswnhayhnryglirndihtqtktlkksakwfaelgerngf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5navF (F:)
    mggshhhhhhgddddkmvefpegfvwgaatsgpqtegnfhkqhqnvfdywfatepeqfda
    gvgpdtasnfyndydhdlalmaqagvqglrtsiqwtrliddfetaslnadgvafynhvid
    smlahhitpyinlhhfdlpvalydkyhgweskhvvelfvkfaeqcfklfgdrvdhwytfn
    epkvvvdgqylygwhypqvingpkavqvaynmnlasaktvarfhelsvrpeqqigiilnl
    tpayaasddpadlaaaefaelwsnnlfldpavlghfpeklverltmdgvlwdatptelai
    iaanpvdslgvnyyhpfrvqrpdispkslqpwmpdiyfkeydmpgrmmnvdrgweiypqa
    mtdiarniqknygnipwmisengmgvageerfldkqgvvqddyridfmkehltalakgia
    agsncqgyfvwsgidcwswnhayhnryglirndihtqtktlkksakwfaelgerngf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5navF (F:)
    mvefpegfvwgaatsgpqtegnfhkqhqnvfdywfatepeqfdagvgpdtasnfyndydh
    dlalmaqagvqglrtsiqwtrliddfetaslnadgvafynhvidsmlahhitpyinlhhf
    dlpvalydkyhgweskhvvelfvkfaeqcfklfgdrvdhwytfnepkvvvdgqylygwhy
    pqvingpkavqvaynmnlasaktvarfhelsvrpeqqigiilnltpayaasddpadlaaa
    efaelwsnnlfldpavlghfpeklverltmdgvlwdatptelaiiaanpvdslgvnyyhp
    frvqrpdispkslqpwmpdiyfkeydmpgrmmnvdrgweiypqamtdiarniqknygnip
    wmisengmgvageerfldkqgvvqddyridfmkehltalakgiaagsncqgyfvwsgidc
    wswnhayhnryglirndihtqtktlkksakwfaelgerngf