PDB entry 5n9v

View 5n9v on RCSB PDB site
Description: NMR solution structure of ubl5 domain from polyubiquitin locus of T.thermophila.
Class: transferase
Keywords: beta-grasp, ULD, polyubiquitin, transferase
Deposited on 2017-02-27, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD(P)(+)--arginine ADP-ribosyltransferase
    Species: Tetrahymena thermophila [TaxId:312017]
    Gene: TTHERM_00085190
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q236S9 (3-80)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d5n9va1, d5n9va2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5n9vA (A:)
    shmqvsiefqngeklkfnvqpshkildikemifkktninvkdqslkfagneminqktlsd
    ysiidsteeftlhletkldlm