PDB entry 5n9s

View 5n9s on RCSB PDB site
Description: TTK kinase domain in complex with BAY 1161909
Class: transferase
Keywords: kinase, inhibitor, mitosis, Mps1, TRANSFERASE
Deposited on 2017-02-27, released 2017-05-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-06-07, with a file datestamp of 2017-06-02.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dual specificity protein kinase TTK
    Species: Homo sapiens [TaxId:9606]
    Gene: TTK, MPS1, MPS1L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33981 (23-End)
      • expression tag (20-22)
    Domains in SCOPe 2.06: d5n9sa1, d5n9sa2
  • Heterogens: 8QW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5n9sA (A:)
    mhhhhhhssgvdlgtenlyfqsmsvkgriysilkqigsggsskvfqvlnekkqiyaikyv
    nleeadnqtldsyrneiaylnklqqhsdkiirlydyeitdqyiymvmecgnidlnswlkk
    kksidpwerksywknmleavhtihqhgivhsdlkpanflivdgmlklidfgianqmqpdt
    tsvvkdsqvgtvnymppeaikdmsssrengkskskispksdvwslgcilyymtygktpfq
    qiinqisklhaiidpnheiefpdipekdlqdvlkcclkrdpkqrisipellahpyvqiqt
    hlvnqmakgttee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n9sA (A:)
    qsmsvkgriysilkqigsggsskvfqvlnekkqiyaikyvnleeadnqtldsyrneiayl
    nklqqhsdkiirlydyeitdqyiymvmecgnidlnswlkkkksidpwerksywknmleav
    htihqhgivhsdlkpanflivdgmlklidfgianqmqpdsqvgtvnymppeaikdkispk
    sdvwslgcilyymtygktpfqqiinqisklhaiidpnheiefpdipekdlqdvlkcclkr
    dpkqrisipellahpyvqiq