PDB entry 5n7j

View 5n7j on RCSB PDB site
Description: Crystal structure of Neisseria polysaccharea amylosucrase mutant efficient for the synthesis of controlled size maltooligosaccharides
Class: hydrolase
Keywords: amylosucrase, Glycoside hydrolase, Glucosyl transferase, mutant, Neisseria polysaccharea, GH13, HYDROLASE
Deposited on 2017-02-20, released 2017-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amylosucrase
    Species: Neisseria polysaccharea [TaxId:489]
    Gene: ams
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZEU2 (4-627)
      • expression tag (0-3)
      • engineered mutation (225)
      • engineered mutation (227)
      • engineered mutation (288-289)
      • engineered mutation (299)
      • engineered mutation (330)
      • engineered mutation (436)
      • engineered mutation (438)
      • engineered mutation (444)
      • engineered mutation (536)
    Domains in SCOPe 2.07: d5n7ja1, d5n7ja2, d5n7ja3
  • Heterogens: TRS, SUC, MLR, 1PE, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5n7jA (A:)
    spnsqylktrildiytpeqragieksedwrqfsrrmdthfpklmneldsvygnneallpm
    lemllaqawqsysqrnsslkdidiarennpdwilsnkqvggvcyvdlfagdlkglkdkip
    yfqelgltylhlmplfkcpegksdggyavssyrdvnpalgtigdlreviaalheagisav
    vdfifnhtsnehewaqrcaagdplfdnfyyifpdrrmpdqydrtlkevfpdqhpggfsql
    edgrwvwttfnsfqwdlnysnpwvframagemlflanlgvdilrmdaviyiwkqmgtsci
    nlpqahalirafnavmriaapavffkseaithpdqvvqyigqdecqigynplqmallwnt
    latrevnllhqaltyrhnlpehtawvnyvrshddigwtfadedaaylgisgydhrqflnr
    ffvnrfdgsfargvpfsydpstgdarvsgtaaalvglaqddphavdrikllysialstgg
    lpliylgdevgtlndddwsqdsnksddsrwahrprynealyaqrndpstaagqiyqdlrh
    miavrqsnprfdggrlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfka
    hdliggktvslnqdltlqpyqvmwleia