PDB entry 5n6v

View 5n6v on RCSB PDB site
Description: Crystal structure of Neisseria polysaccharea amylosucrase mutant derived from Neutral genetic Drift-based engineering
Class: hydrolase
Keywords: Glycoside hydrolase Glucosyl transferase variant neutral drift, Hydrolase
Deposited on 2017-02-16, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amylosucrase
    Species: Neisseria polysaccharea [TaxId:489]
    Gene: ams
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZEU2 (4-627)
      • expression tag (0-3)
      • engineered mutation (36)
      • engineered mutation (330)
      • engineered mutation (525)
      • conflict (536)
      • engineered mutation (608)
    Domains in SCOPe 2.07: d5n6va1, d5n6va2, d5n6va3
  • Heterogens: TRS, SUC, GLC, EPE, PGE, FRU, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5n6vA (A:)
    spnsqylktrildiytpeqragieksedwrqfsrrmhthfpklmneldsvygnneallpm
    lemllaqawqsysqrnsslkdidiarennpdwilsnkqvggvcyvdlfagdlkglkdkip
    yfqelgltylhlmplfkcpegksdggyavssyrdvnpalgtigdlreviaalheagisav
    vdfifnhtsnehewaqrcaagdplfdnfyyifpdrrmpdqydrtlreifpdqhpggfsql
    edgrwvwttfnsfqwdlnysnpwvframagemlflanlgvdilrmdavafiwkqmgtsce
    nlpqahalirafnavmriaapavffkseaidhpdqvvqyigqdecqigynplqmallwnt
    latrevnllhqaltyrhnlpehtawvnyvrshddigwtfadedaaylgisgydhrqflnr
    ffvnrfdgsfargvpfqynpstgdcrvsgtaaalvglaqddphavdrikllysialstgg
    lpliylgdevgtlndddwsqdsnksddsrwahrprynealyaqrnnpstaagqiyqdlrh
    miavrqsnprfdggrlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfka
    hdliggktislnqdltlqpyqvmwleia