PDB entry 5n6n

View 5n6n on RCSB PDB site
Description: crystal structure of the 14-3-3:neutral trehalase nth1 complex
Class: signaling protein
Keywords: 14-3-3, neutral trehalase, signaling protein, hydrolase
Deposited on 2017-02-15, released 2017-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein BMH1
    Species: SACCHAROMYCES CEREVISIAE S288C [TaxId:559292]
    Gene: BMH1, YER177W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5n6na_
  • Chain 'B':
    Compound: Protein BMH1
    Species: SACCHAROMYCES CEREVISIAE S288C [TaxId:559292]
    Gene: BMH1, YER177W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5n6nb_
  • Chain 'C':
    Compound: Neutral trehalase
    Species: SACCHAROMYCES CEREVISIAE S288C [TaxId:559292]
    Gene: NTH1, NTH, YDR001C, YD8119.07C
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, SUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5n6nA (A:)
    gshmmstsredsvylaklaeqaeryeemvenmktvassgqelsveernllsvayknviga
    rraswrivssieqkeeskeksehqvelicsyrskieteltkisddilsvldshlipsatt
    geskvfyykmkgdyhrylaefssgdarekatnasleayktaseiattelppthpirlgla
    lnfsvfyyeiqnspdkachlakqafddaiaeldtlseesykdstlimqllrdnltlwtsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n6nA (A:)
    redsvylaklaeqaeryeemvenmktvassgqelsveernllsvayknvigarraswriv
    ssieqkeeskeksehqvelicsyrskieteltkisddilsvldshlipsattgeskvfyy
    kmkgdyhrylaefssgdarekatnasleayktaseiattelppthpirlglalnfsvfyy
    eiqnspdkachlakqafddaiaeldtlseesykdstlimqllrdnltlwts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5n6nB (B:)
    gshmmstsredsvylaklaeqaeryeemvenmktvassgqelsveernllsvayknviga
    rraswrivssieqkeeskeksehqvelicsyrskieteltkisddilsvldshlipsatt
    geskvfyykmkgdyhrylaefssgdarekatnasleayktaseiattelppthpirlgla
    lnfsvfyyeiqnspdkachlakqafddaiaeldtlseesykdstlimqllrdnltlwtsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n6nB (B:)
    sredsvylaklaeqaeryeemvenmktvassgqelsveernllsvayknvigarraswri
    vssieqkeeskeksehqvelicsyrskieteltkisddilsvldshlipsattgeskvfy
    ykmkgdyhrylaefssgdarekatnasleayktaseiattelppthpirlglalnfsvfy
    yeiqnspdkachlakqafddaiaelykdstlimqllrdnltlwt
    

  • Chain 'C':
    No sequence available.