PDB entry 5n5q

View 5n5q on RCSB PDB site
Description: Human TTR altered conformation from soaking in iron chloride.
Class: transport protein
Keywords: Conformational change, Iron clusters, metal binding protein, Alzheimer beta-amyloid scavenging, Transport protein
Deposited on 2017-02-14, released 2018-03-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5n5qa_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5n5qb_
  • Heterogens: ACT, FFE, FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5n5qA (A:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5n5qB (B:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp