PDB entry 5n57

View 5n57 on RCSB PDB site
Description: Staphylococcus aureus cambialistic superoxide dismutase SodM
Class: oxidoreductase
Keywords: superoxide dismutase, cambialistic, Staphylococcus aureus, OXIDOREDUCTASE
Deposited on 2017-02-13, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: sodA, sodM, A4U86_04870, BN1321_40056, ERS072738_00830, ERS072840_00559, ERS073147_02394, ERS073767_02269, ERS074020_00889, ERS1058648_00955, FORC27_0128, HMPREF3211_00238, SAMEA2298760_02426
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5n57a1, d5n57a2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: sodA, sodM, A4U86_04870, BN1321_40056, ERS072738_00830, ERS072840_00559, ERS073147_02394, ERS073767_02269, ERS074020_00889, ERS1058648_00955, FORC27_0128, HMPREF3211_00238, SAMEA2298760_02426
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5n57b1, d5n57b2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5n57A (A:)
    mafklpnlpyaydalepyidqrtmefhhdkhhntyvtklnatvegtelehqsladmianl
    dkvpeamrmsvrnnggghfnhslfweilspnseekggviddikaqwgtldefknefanka
    ttlfgsgwtwlvvndgkleivttpnqdnpltegktpillfdvwehayylkyqnkrpdymt
    afwnivnwkkvdelyqaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n57A (A:)
    afklpnlpyaydalepyidqrtmefhhdkhhntyvtklnatvegtelehqsladmianld
    kvpeamrmsvrnnggghfnhslfweilspnseekggviddikaqwgtldefknefankat
    tlfgsgwtwlvvndgkleivttpnqdnpltegktpillfdvwehayylkyqnkrpdymta
    fwnivnwkkvdelyqaak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5n57B (B:)
    mafklpnlpyaydalepyidqrtmefhhdkhhntyvtklnatvegtelehqsladmianl
    dkvpeamrmsvrnnggghfnhslfweilspnseekggviddikaqwgtldefknefanka
    ttlfgsgwtwlvvndgkleivttpnqdnpltegktpillfdvwehayylkyqnkrpdymt
    afwnivnwkkvdelyqaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n57B (B:)
    afklpnlpyaydalepyidqrtmefhhdkhhntyvtklnatvegtelehqsladmianld
    kvpeamrmsvrnnggghfnhslfweilspnseekggviddikaqwgtldefknefankat
    tlfgsgwtwlvvndgkleivttpnqdnpltegktpillfdvwehayylkyqnkrpdymta
    fwnivnwkkvdelyqaak