PDB entry 5n56

View 5n56 on RCSB PDB site
Description: Staphylococcus aureus Mn-dependent superoxide dismutase SodA
Class: oxidoreductase
Keywords: superoxide dismutase, Mn-dependent, Staphylococcus aureus, OXIDOREDUCTASE
Deposited on 2017-02-13, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn/Fe] 1
    Species: Staphylococcus aureus (strain bovine RF122 / ET3-1) [TaxId:273036]
    Gene: sodA, SAB1425c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5n56a1, d5n56a2
  • Chain 'B':
    Compound: Superoxide dismutase [Mn/Fe] 1
    Species: Staphylococcus aureus (strain bovine RF122 / ET3-1) [TaxId:273036]
    Gene: sodA, SAB1425c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5n56b1, d5n56b2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5n56A (A:)
    mafelpklpyafdalephfdketmeihhdrhhntyvtklnaavegtdlesksieeivanl
    dsvpaniqtavrnnggghlnhslfwellspnseekgtvvekikeqwgsleefkkefadka
    aarfgsgwawlvvnngqleivttpnqdnpltegktpilgldvwehayylkyqnkrpdyig
    afwnvvnwekvdelynatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n56A (A:)
    afelpklpyafdalephfdketmeihhdrhhntyvtklnaavegtdlesksieeivanld
    svpaniqtavrnnggghlnhslfwellspnseekgtvvekikeqwgsleefkkefadkaa
    arfgsgwawlvvnngqleivttpnqdnpltegktpilgldvwehayylkyqnkrpdyiga
    fwnvvnwekvdelynatk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5n56B (B:)
    mafelpklpyafdalephfdketmeihhdrhhntyvtklnaavegtdlesksieeivanl
    dsvpaniqtavrnnggghlnhslfwellspnseekgtvvekikeqwgsleefkkefadka
    aarfgsgwawlvvnngqleivttpnqdnpltegktpilgldvwehayylkyqnkrpdyig
    afwnvvnwekvdelynatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5n56B (B:)
    afelpklpyafdalephfdketmeihhdrhhntyvtklnaavegtdlesksieeivanld
    svpaniqtavrnnggghlnhslfwellspnseekgtvvekikeqwgsleefkkefadkaa
    arfgsgwawlvvnngqleivttpnqdnpltegktpilgldvwehayylkyqnkrpdyiga
    fwnvvnwekvdelynatk