PDB entry 5n4m

View 5n4m on RCSB PDB site
Description: Human myelin protein P2, mutant I43N
Class: lipid binding protein
Keywords: fatty acid binding protein, lipid binding protein
Deposited on 2017-02-11, released 2017-08-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myelin p2 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PMP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02689 (1-132)
      • expression tag (0)
      • engineered mutation (43)
    Domains in SCOPe 2.08: d5n4ma1, d5n4ma2
  • Heterogens: PLM, VCA, MLT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5n4mA (A:)
    gmsnkflgtwklvssenfddymkalgvglatrklgnlakptvinskkgdiitirtestfk
    nteisfklgqefeettadnrktksivtlqrgslnqvqrwdgkettikrklvngkmvaeck
    mkgvvctriyekv