PDB entry 5n13

View 5n13 on RCSB PDB site
Description: Second Bromodomain (BD2) from Candida albicans Bdf1 in the unbound form
Class: transcription
Keywords: Bromodomain, transcription
Deposited on 2017-02-04, released 2017-05-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-05-31, with a file datestamp of 2017-05-26.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing factor 1
    Species: Candida albicans [TaxId:5476]
    Gene: BDF1, CaO19.8593, CaO19.978
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5A4W8 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d5n13a1, d5n13a2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5n13A (A:)
amgaaelrfcnqtikelmskkhynynfpflapvdtvalnipnyneivkqpmdlgtiqskl
anneyenaddfekdvrlvfkncylfnpegtdvnmmghrleavfdkkwan

    Sequence, based on observed residues (ATOM records): (download) 
    >5n13A (A:)
amgaaelrfcnqtikelmskkhynynfpflapvdtvalnipnyneivkqpmdlgtiqskl
anneyenaddfekdvrlvfkncylfnpegtdvnmmghrleavfdkkwa