PDB entry 5mzy

View 5mzy on RCSB PDB site
Description: Crystal structure of the decarboxylase AibA/AibB in complex with a possible transition state analog
Class: lyase
Keywords: decarboxylase, CoA transferase like fold, transition state analog, lyase
Deposited on 2017-02-02, released 2017-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutaconate CoA-transferase family, subunit A
    Species: Myxococcus xanthus (strain DK 1622) [TaxId:246197]
    Gene: MXAN_4264
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1D4I4 (0-End)
      • engineered mutation (190)
  • Chain 'B':
    Compound: Glutaconate CoA-transferase family, subunit B
    Species: Myxococcus xanthus (strain DK 1622) [TaxId:246197]
    Gene: MXAN_4265
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1D4I3 (Start-247)
      • engineered mutation (201-202)
    Domains in SCOPe 2.07: d5mzyb_
  • Chain 'C':
    Compound: Glutaconate CoA-transferase family, subunit A
    Species: Myxococcus xanthus (strain DK 1622) [TaxId:246197]
    Gene: MXAN_4264
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1D4I4 (0-End)
      • engineered mutation (190)
  • Chain 'D':
    Compound: Glutaconate CoA-transferase family, subunit B
    Species: Myxococcus xanthus (strain DK 1622) [TaxId:246197]
    Gene: MXAN_4265
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1D4I3 (Start-247)
      • engineered mutation (201-202)
    Domains in SCOPe 2.07: d5mzyd_
  • Heterogens: GOL, ACT, 8EZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5mzyB (B:)
    phmsatlditpaetvvsllarqiddggvvatgvasplailaiavarathapdltylacvg
    sldpeiptllpssedlgyldgrsaeitipdlfdharrgrvdtvffgaaevdaegrtnmta
    sgsldkprtkfpgvagaatlrqwvrrpvllvprqsrrnlvpevqvattrdprrpvtlisd
    lgvfelgasgarllarhpwasaahiaertgfafqvsealsvtslpdartvaairaidphg
    yrdalvga
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mzyB (B:)
    atlditpaetvvsllarqiddggvvatgvasplailaiavarathapdltylacvgsldp
    eiptllpssedlgyldgrsaeitipdlfdharrgrvdtvffgaaevdaegrtnmtasgsl
    dkprtkfpgvagaatlrqwvrrpvllvprqsrrnlvpevqvattrdprrpvtlisdlgvf
    elgasgarllarhpwasaahiaertgfafqvsealsvtslpdartvaairaidphgyrda
    lvga
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5mzyD (D:)
    phmsatlditpaetvvsllarqiddggvvatgvasplailaiavarathapdltylacvg
    sldpeiptllpssedlgyldgrsaeitipdlfdharrgrvdtvffgaaevdaegrtnmta
    sgsldkprtkfpgvagaatlrqwvrrpvllvprqsrrnlvpevqvattrdprrpvtlisd
    lgvfelgasgarllarhpwasaahiaertgfafqvsealsvtslpdartvaairaidphg
    yrdalvga
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mzyD (D:)
    ditpaetvvsllarqiddggvvatgvasplailaiavarathapdltylacvgsldpeip
    tllpssedlgyldgrsaeitipdlfdharrgrvdtvffgaaevdaegrtnmtasgsldkp
    rtkfpgvagaatlrqwvrrpvllvprqsrrnlvpevqvattrdprrpvtlisdlgvfelg
    asgarllarhpwasaahiaertgfafqvsealsvtslpdartvaairaidphgyrdalvg
    a