PDB entry 5mza

View 5mza on RCSB PDB site
Description: The DBLb domain of PF11_0521 PfEMP1 bound to human ICAM-1
Class: cell adhesion
Keywords: PfEMP1 ICAM-1 Cerebral malaria, Cell adhesion
Deposited on 2017-01-31, released 2017-03-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-22, with a file datestamp of 2017-03-17.
Experiment type: XRAY
Resolution: 2.78 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: erythrocyte membrane protein 1 (pfemp1)
    Species: Plasmodium falciparum 3D7 [TaxId:36329]
    Gene: PF11_0521, PF3D7_1150400
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IHM0 (1-487)
      • expression tag (0)
  • Chain 'B':
    Compound: Intercellular adhesion molecule 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ICAM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05362 (0-184)
      • expression tag (185)
    Domains in SCOPe 2.06: d5mzab1, d5mzab2, d5mzab3
  • Heterogens: 3PO, NAG, IHP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5mzaB (B:)
    qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed
    sqpmcysncpdgqstaktfltvywtpervelaplpswqpvgknltlrcqveggapranlt
    vvllrgekelkrepavgepaevtttvlvrrdhhganfscrteldlrpqglelfentsapy
    qlqtfg