PDB entry 5mz8

View 5mz8 on RCSB PDB site
Description: Crystal structure of aldehyde dehydrogenase 21 (ALDH21) from Physcomitrella patens in complex with the reaction product succinate
Class: oxidoreductase
Keywords: Rossmann fold, oxidoreductase, succinic semialdehyde dehydrogenase, NADP+ binding
Deposited on 2017-01-31, released 2017-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldehyde dehydrogenase 21
    Species: Physcomitrella patens subsp. patens [TaxId:3218]
    Gene: PHYPADRAFT_215149
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mz8a_
  • Chain 'B':
    Compound: aldehyde dehydrogenase 21
    Species: Physcomitrella patens subsp. patens [TaxId:3218]
    Gene: PHYPADRAFT_215149
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mz8b_
  • Chain 'C':
    Compound: aldehyde dehydrogenase 21
    Species: Physcomitrella patens subsp. patens [TaxId:3218]
    Gene: PHYPADRAFT_215149
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mz8c_
  • Chain 'D':
    Compound: aldehyde dehydrogenase 21
    Species: Physcomitrella patens subsp. patens [TaxId:3218]
    Gene: PHYPADRAFT_215149
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mz8d_
  • Heterogens: SIN, EDO, PEG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mz8A (A:)
    mgsshhhhhhsqdpnsssmtlghmvqkakessgdvtpkkyniflaskpvdgdrkwldvtn
    kytndvaakvpqathkdiddaidaavaaapamaamgayerkavlekvvaelknrfeeiaq
    tltmesgkpikdargevtrtidtfqvaaeesvriygehipldisarnkglqgivkkfpig
    pvsmvspwnfplnlvahkvapaiavgcpfvlkpasrtplsalilgeilhkieelplgafs
    ilpvsredadmftvderfklltftgsgpigwdmkaragkkkvvmelggnapcivddyvpd
    ldytiqrlinggfyqggqscihmqrlyvherlydevkegfvaavkklkmgnpfeedtylg
    pmisesaakgiedwvkeavakggklltggnrkgafieptviedvpieanarkeeifgpvv
    llykysdfkeavkecnnthyglqsgiftkdlnkafyafehmevggvilndspalrvdsqp
    ygglkdsgiqregvkyamddmletkvlvmrnvgtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mz8A (A:)
    vtpkkyniflaskpvdgdrkwldvtnkytndvaakvpqathkdiddaidaavaaapamaa
    mgayerkavlekvvaelknrfeeiaqtltmesgkpikdargevtrtidtfqvaaeesvri
    ygehipldisarnkglqgivkkfpigpvsmvspwnfplnlvahkvapaiavgcpfvlkpa
    srtplsalilgeilhkieelplgafsilpvsredadmftvderfklltftgsgpigwdmk
    aragkkkvvmelggnapcivddyvpdldytiqrlinggfyqggqscihmqrlyvherlyd
    evkegfvaavkklkmgnpfeedtylgpmisesaakgiedwvkeavakggklltggnrkga
    fieptviedvpieanarkeeifgpvvllykysdfkeavkecnnthyglqsgiftkdlnka
    fyafehmevggvilndspalrvdsqpygglkdsgiqregvkyamddmletkvlvmrnvgt
    l
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5mz8B (B:)
    mgsshhhhhhsqdpnsssmtlghmvqkakessgdvtpkkyniflaskpvdgdrkwldvtn
    kytndvaakvpqathkdiddaidaavaaapamaamgayerkavlekvvaelknrfeeiaq
    tltmesgkpikdargevtrtidtfqvaaeesvriygehipldisarnkglqgivkkfpig
    pvsmvspwnfplnlvahkvapaiavgcpfvlkpasrtplsalilgeilhkieelplgafs
    ilpvsredadmftvderfklltftgsgpigwdmkaragkkkvvmelggnapcivddyvpd
    ldytiqrlinggfyqggqscihmqrlyvherlydevkegfvaavkklkmgnpfeedtylg
    pmisesaakgiedwvkeavakggklltggnrkgafieptviedvpieanarkeeifgpvv
    llykysdfkeavkecnnthyglqsgiftkdlnkafyafehmevggvilndspalrvdsqp
    ygglkdsgiqregvkyamddmletkvlvmrnvgtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mz8B (B:)
    tpkkyniflaskpvdgdrkwldvtnkytndvaakvpqathkdiddaidaavaaapamaam
    gayerkavlekvvaelknrfeeiaqtltmesgkpikdargevtrtidtfqvaaeesvriy
    gehipldisarnkglqgivkkfpigpvsmvspwnfplnlvahkvapaiavgcpfvlkpas
    rtplsalilgeilhkieelplgafsilpvsredadmftvderfklltftgsgpigwdmka
    ragkkkvvmelggnapcivddyvpdldytiqrlinggfyqggqscihmqrlyvherlyde
    vkegfvaavkklkmgnpfeedtylgpmisesaakgiedwvkeavakggklltggnrkgaf
    ieptviedvpieanarkeeifgpvvllykysdfkeavkecnnthyglqsgiftkdlnkaf
    yafehmevggvilndspalrvdsqpygglkdsgiqregvkyamddmletkvlvmrnvgtl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5mz8C (C:)
    mgsshhhhhhsqdpnsssmtlghmvqkakessgdvtpkkyniflaskpvdgdrkwldvtn
    kytndvaakvpqathkdiddaidaavaaapamaamgayerkavlekvvaelknrfeeiaq
    tltmesgkpikdargevtrtidtfqvaaeesvriygehipldisarnkglqgivkkfpig
    pvsmvspwnfplnlvahkvapaiavgcpfvlkpasrtplsalilgeilhkieelplgafs
    ilpvsredadmftvderfklltftgsgpigwdmkaragkkkvvmelggnapcivddyvpd
    ldytiqrlinggfyqggqscihmqrlyvherlydevkegfvaavkklkmgnpfeedtylg
    pmisesaakgiedwvkeavakggklltggnrkgafieptviedvpieanarkeeifgpvv
    llykysdfkeavkecnnthyglqsgiftkdlnkafyafehmevggvilndspalrvdsqp
    ygglkdsgiqregvkyamddmletkvlvmrnvgtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mz8C (C:)
    vtpkkyniflaskpvdgdrkwldvtnkytndvaakvpqathkdiddaidaavaaapamaa
    mgayerkavlekvvaelknrfeeiaqtltmesgkpikdargevtrtidtfqvaaeesvri
    ygehipldisarnkglqgivkkfpigpvsmvspwnfplnlvahkvapaiavgcpfvlkpa
    srtplsalilgeilhkieelplgafsilpvsredadmftvderfklltftgsgpigwdmk
    aragkkkvvmelggnapcivddyvpdldytiqrlinggfyqggqscihmqrlyvherlyd
    evkegfvaavkklkmgnpfeedtylgpmisesaakgiedwvkeavakggklltggnrkga
    fieptviedvpieanarkeeifgpvvllykysdfkeavkecnnthyglqsgiftkdlnka
    fyafehmevggvilndspalrvdsqpygglkdsgiqregvkyamddmletkvlvmrnvgt
    l
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5mz8D (D:)
    mgsshhhhhhsqdpnsssmtlghmvqkakessgdvtpkkyniflaskpvdgdrkwldvtn
    kytndvaakvpqathkdiddaidaavaaapamaamgayerkavlekvvaelknrfeeiaq
    tltmesgkpikdargevtrtidtfqvaaeesvriygehipldisarnkglqgivkkfpig
    pvsmvspwnfplnlvahkvapaiavgcpfvlkpasrtplsalilgeilhkieelplgafs
    ilpvsredadmftvderfklltftgsgpigwdmkaragkkkvvmelggnapcivddyvpd
    ldytiqrlinggfyqggqscihmqrlyvherlydevkegfvaavkklkmgnpfeedtylg
    pmisesaakgiedwvkeavakggklltggnrkgafieptviedvpieanarkeeifgpvv
    llykysdfkeavkecnnthyglqsgiftkdlnkafyafehmevggvilndspalrvdsqp
    ygglkdsgiqregvkyamddmletkvlvmrnvgtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mz8D (D:)
    vtpkkyniflaskpvdgdrkwldvtnkytndvaakvpqathkdiddaidaavaaapamaa
    mgayerkavlekvvaelknrfeeiaqtltmesgkpikdargevtrtidtfqvaaeesvri
    ygehipldisarnkglqgivkkfpigpvsmvspwnfplnlvahkvapaiavgcpfvlkpa
    srtplsalilgeilhkieelplgafsilpvsredadmftvderfklltftgsgpigwdmk
    aragkkkvvmelggnapcivddyvpdldytiqrlinggfyqggqscihmqrlyvherlyd
    evkegfvaavkklkmgnpfeedtylgpmisesaakgiedwvkeavakggklltggnrkga
    fieptviedvpieanarkeeifgpvvllykysdfkeavkecnnthyglqsgiftkdlnka
    fyafehmevggvilndspalrvdsqpygglkdsgiqregvkyamddmletkvlvmrnvgt
    l