PDB entry 5mxc

View 5mxc on RCSB PDB site
Description: Aleuria aurantia lectin (AAL) N224Q mutant in complex with alpha-methyl-L-fucoside
Class: sugar binding protein
Keywords: lectin, six-bladed beta-propeller, alpha-methyl fucoside, sugar binding protein
Deposited on 2017-01-22, released 2017-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 1.14 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fucose-specific lectin
    Species: Aleuria aurantia [TaxId:5188]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18891 (Start-312)
      • engineered mutation (224)
      • expression tag (313)
    Domains in SCOPe 2.07: d5mxca1, d5mxca2
  • Heterogens: MFU, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mxcA (A:)
    mpteflytskiaaiswaatggrqqrvyfqdlngkireaqrggdnpwtggssqnvigeakl
    fsplaavtwksaqgiqirvycvnkdnilsefvydgskwitgqlgsvgvkvgsnsklaalq
    wggsesappnirvyyqksngsgssiheyvwsgkwtagasfgstvpgtgigataigpgrlr
    iyyqatdnkirehcwdsnswyvggfsasasagvsiaaiswgstpqirvywqkgreelyea
    ayggswntpgqikdasrptpslpdtfiaanssgnidisvffqasgvslqqwqwisgkgws
    igavvptgtpagwlehhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mxcA (A:)
    pteflytskiaaiswaatggrqqrvyfqdlngkireaqrggdnpwtggssqnvigeaklf
    splaavtwksaqgiqirvycvnkdnilsefvydgskwitgqlgsvgvkvgsnsklaalqw
    ggsesappnirvyyqksngsgssiheyvwsgkwtagasfgstvpgtgigataigpgrlri
    yyqatdnkirehcwdsnswyvggfsasasagvsiaaiswgstpqirvywqkgreelyeaa
    yggswntpgqikdasrptpslpdtfiaanssgnidisvffqasgvslqqwqwisgkgwsi
    gavvptgtpagwl