PDB entry 5mvs

View 5mvs on RCSB PDB site
Description: Crystal structure of Dot1L in complex with adenosine and inhibitor CPD1 [N6-(2,6-dichlorophenyl)-N6-(pent-2-yn-1-yl)quinoline-4,6-diamine]
Class: transferase
Keywords: inhibitor, complex, methyltransferase, transferase
Deposited on 2017-01-17, released 2017-03-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-22, with a file datestamp of 2017-03-17.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone-lysine N-methyltransferase, H3 lysine-79 specific
    Species: Homo sapiens [TaxId:9606]
    Gene: DOT1L, KIAA1814, KMT4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5mvsa_
  • Chain 'B':
    Compound: Histone-lysine N-methyltransferase, H3 lysine-79 specific
    Species: Homo sapiens [TaxId:9606]
    Gene: DOT1L, KIAA1814, KMT4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5mvsb_
  • Heterogens: ADN, 5JJ, TLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mvsA (A:)
    gpgeklelrlkspvgaepavypwplpvydkhhdaaheiietirwvceeipdlklamenyv
    lidydtksfesmqrlcdkynraidsihqlwkgttqpmklntrpstgllrhilqqvynhsv
    tdpeklnnyepfspevygetsfdlvaqmideikmtdddlfvdlgsgvgqvvlqvaaatnc
    khhygvekadipakyaetmdrefrkwmkwygkkhaeytlergdflseewreriantsvif
    vnnfafgpevdhqlkerfanmkeggrivsskpfaplnfrinsrnlsdigtimrvvelspl
    kgsvswtgkpvsyylhtidrtilenyfsslknpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mvsA (A:)
    lelrlkspvgaepavypwplpvydkhhdaaheiietirwvceeipdlklamenyvlidyd
    tksfesmqrlcdkynraidsihqlwkgtntrpstgllrhilqqvynhsvtdpeklnnyep
    fspevygetsfdlvaqmideikmtdddlfvdlgsgvgqvvlqvaaatnckhhygvekadi
    pakyaetmdrefrkwmkwygkkhaeytlergdflseewreriantsvifvnnfafgpevd
    hqlkerfanmkeggrivsskpfaplnfrinsrnlsdigtimrvvelsplkgswtgkpvsy
    ylhtidrtilenyfsslknp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5mvsB (B:)
    gpgeklelrlkspvgaepavypwplpvydkhhdaaheiietirwvceeipdlklamenyv
    lidydtksfesmqrlcdkynraidsihqlwkgttqpmklntrpstgllrhilqqvynhsv
    tdpeklnnyepfspevygetsfdlvaqmideikmtdddlfvdlgsgvgqvvlqvaaatnc
    khhygvekadipakyaetmdrefrkwmkwygkkhaeytlergdflseewreriantsvif
    vnnfafgpevdhqlkerfanmkeggrivsskpfaplnfrinsrnlsdigtimrvvelspl
    kgsvswtgkpvsyylhtidrtilenyfsslknpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mvsB (B:)
    klelrlkspvgaepavypwplpvydkhhdaaheiietirwvceeipdlklamenyvlidy
    dtksfesmqrlcdkynraidsihqlwkgtntrpstgllrhilqqvynhsvtdpeklnnye
    pfspevygetsfdlvaqmideikmtdddlfvdlgsgvgqvvlqvaaatnckhhygvekad
    ipakyaetmdrefrkwmkwygkkhaeytlergdflseewreriantsvifvnnfafgpev
    dhqlkerfanmkeggrivsskpfaplnfrinsrnlsdigtimrvvelsplkgsvswtgkp
    vsyylhtidrtilenyfsslkn