PDB entry 5mvj

View 5mvj on RCSB PDB site
Description: Structure of DC8E8 Fab at pH 6.5 crystallized in space-group P1
Class: immune system
Keywords: Fab, IMMUNE SYSTEM
Deposited on 2017-01-16, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MVJ (0-220)
  • Chain 'B':
    Compound: antibody kappa chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MVJ (0-End)
    Domains in SCOPe 2.07: d5mvjb1, d5mvjb2
  • Chain 'C':
    Compound: antibody fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MVJ (0-End)
  • Chain 'D':
    Compound: antibody kappa chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MVJ (0-End)
    Domains in SCOPe 2.07: d5mvjd1, d5mvjd2
  • Chain 'E':
    Compound: antibody fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MVJ (0-220)
  • Chain 'F':
    Compound: antibody kappa chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MVJ (0-End)
    Domains in SCOPe 2.07: d5mvjf1, d5mvjf2
  • Chain 'H':
    Compound: antibody fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MVJ (0-End)
  • Chain 'L':
    Compound: antibody kappa chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MVJ (0-218)
    Domains in SCOPe 2.07: d5mvjl1, d5mvjl2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5mvjB (B:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsfylrtfgggtkldikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvrwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mvjB (B:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsfylrtfgggtkldikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvrwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5mvjD (D:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsfylrtfgggtkldikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvrwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mvjD (D:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsfylrtfgggtkldikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvrwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5mvjF (F:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsfylrtfgggtkldikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvrwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mvjF (F:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsfylrtfgggtkldikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvrwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5mvjL (L:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsfylrtfgggtkldikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvrwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec