PDB entry 5mv2

View 5mv2 on RCSB PDB site
Description: Crystal structure of the E protein of the Japanese encephalitis live attenuated vaccine virus
Class: viral protein
Keywords: viral envelope glycoprotein, viral protein
Deposited on 2017-01-14, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E protein
    Species: Japanese encephalitis virus (strain SA-14) [TaxId:11073]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8QQT1 (10-End)
      • expression tag (0-9)
    Domains in SCOPe 2.07: d5mv2a1, d5mv2a2, d5mv2a3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mv2A (A:)
    enlyfqggihfnclgmgnrdfiegasgatwvdlvlegdscltimandkptldvrminiea
    sqlaevrsycyhasvtdistvarcpttgeahnekradssyvckqgftdrgwgngcgffgk
    gsidtcakfsctskaigrtiqpenikykvgifvhgtttsenhgnysaqvgasqaakftvt
    pnapsvalklgdygevtldceprsglnteafyvmtvgsksflvhrewfhdlalpwtspss
    tawrnrellmefegahatkqsvvalgsqegglhhalagaivveysssvmltsghlkcrlk
    mdklalkgttygmctekfsfaknpvdtghgtvvielsysgsdgpckipivsvaslndmtp
    vgrlvtvnpfvatssanskvlvemeppfgdsyivvgrgdkqinhhwhkagstlgka
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mv2A (A:)
    enlyfqggihfnclgmgnrdfiegasgatwvdlvlegdscltimandkptldvrminiea
    sqlaevrsycyhasvtdistvarcpttgeahnekradssyvckqgftdrgwgngcgffgk
    gsidtcakfsctskaigrtiqpenikykvgifvhgtttsenhgnysaqvgasqaakftvt
    pnapsvalklgdygevtldceprsglnteafyvmtvgsksflvhrewfhdlalpwtspss
    tawrnrellmefegahatkqsvvalgsqegglhhalagaivveysssvmltsghlkcrlk
    mdklalkgttygmctekfsfaknpvdtghgtvvielsysgsdgpckipivsvaslndmtp
    vgrlvtvnpfvatssanskvlvemeppfgdsyivvgrgdkqinhhwhkag