PDB entry 5mr1

View 5mr1 on RCSB PDB site
Description: Crystal structure of the Pleckstrin homology domain of Interactor protein for cytohesin exchange factors 1 (IPCEF1)
Class: signaling protein
Keywords: cytohesin, scaffold protien, Pleckstrin homology, PIP3E, signaling protein
Deposited on 2016-12-21, released 2017-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interactor protein for cytohesin exchange factors 1
    Species: Homo sapiens [TaxId:9606]
    Gene: IPCEF1, KIAA0403
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mr1a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mr1A (A:)
    smadcqgwlykkkekgsflsnkwkkfwvilkgsslywysnqmaekadgfvnlpdftvera
    seckkkhafkishpqiktfyfaaenvqemnvwlnklgsavihq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mr1A (A:)
    adcqgwlykkkekgsflsnkwkkfwvilkgsslywysnqmaekadgfvnlpdftverase
    ckkkhafkishpqiktfyfaaenvqemnvwlnklgsavihq