PDB entry 5mr0

View 5mr0 on RCSB PDB site
Description: Thermophilic archaeal branched-chain amino acid transaminases from Geoglobus acetivorans and Archaeoglobus fulgidus: biochemical and structural characterisation
Class: transferase
Keywords: Thermophilic archaea, branch-chain transaminases, substrate specificity, transferase
Deposited on 2016-12-21, released 2018-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-17, with a file datestamp of 2018-01-12.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative branched-chain-amino-acid aminotransferase
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: ilvE, AF_0933
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mr0a_
  • Chain 'B':
    Compound: Putative branched-chain-amino-acid aminotransferase
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: ilvE, AF_0933
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mr0b_
  • Chain 'C':
    Compound: Putative branched-chain-amino-acid aminotransferase
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: ilvE, AF_0933
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mr0c_
  • Chain 'D':
    Compound: Putative branched-chain-amino-acid aminotransferase
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: ilvE, AF_0933
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mr0d_
  • Chain 'E':
    Compound: Putative branched-chain-amino-acid aminotransferase
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: ilvE, AF_0933
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mr0e_
  • Chain 'F':
    Compound: Putative branched-chain-amino-acid aminotransferase
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: ilvE, AF_0933
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mr0f_
  • Heterogens: PXG, CL, PEG, TAM, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mr0A (A:)
    mlyvymdgefvpeneakvsifdhgflygdgvfegirayngrvfrlkehidrlydsakaid
    leipitkeefmeiiletlrknnlrdayirpivtrgigdlgldprkcqnpsiivitkpwgk
    lygdlyekgltaitvavrrnsfdalppnikslnylnnilakieanakggdeaifldrngy
    vsegsgdnifvvkngaittpptinnlrgitreavieiinrlgipfketniglydlytade
    vfvtgtaaeiapivvidgrkigdgkpgeitrklmeefskltesegvpiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mr0A (A:)
    mlyvymdgefvpeneakvsifdhgflygdgvfegirayngrvfrlkehidrlydsakaid
    leipitkeefmeiiletlrknnlrdayirpivtrgigdlgldprkcqnpsiivitkpwgg
    dlyekgltaitvavrrnsfdalppnikslnylnnilakieanakggdeaifldrngyvse
    gsgdnifvvkngaittpptinnlrgitreavieiinrlgipfketniglydlytadevfv
    tgtaaeiapivvidgrkigdgkpgeitrklmeefskltesegvpiye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5mr0B (B:)
    mlyvymdgefvpeneakvsifdhgflygdgvfegirayngrvfrlkehidrlydsakaid
    leipitkeefmeiiletlrknnlrdayirpivtrgigdlgldprkcqnpsiivitkpwgk
    lygdlyekgltaitvavrrnsfdalppnikslnylnnilakieanakggdeaifldrngy
    vsegsgdnifvvkngaittpptinnlrgitreavieiinrlgipfketniglydlytade
    vfvtgtaaeiapivvidgrkigdgkpgeitrklmeefskltesegvpiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mr0B (B:)
    mlyvymdgefvpeneakvsifdhgflygdgvfegirayngrvfrlkehidrlydsakaid
    leipitkeefmeiiletlrknnlrdayirpivtrgigdlgldprkcqnpsiivitkpwgd
    lyekgltaitvavrrnsfdalppnikslnylnnilakieanakggdeaifldrngyvseg
    sgdnifvvkngaittpptinnlrgitreavieiinrlgipfketniglydlytadevfvt
    gtaaeiapivvidgrkigdgkpgeitrklmeefskltesegvpiye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5mr0C (C:)
    mlyvymdgefvpeneakvsifdhgflygdgvfegirayngrvfrlkehidrlydsakaid
    leipitkeefmeiiletlrknnlrdayirpivtrgigdlgldprkcqnpsiivitkpwgk
    lygdlyekgltaitvavrrnsfdalppnikslnylnnilakieanakggdeaifldrngy
    vsegsgdnifvvkngaittpptinnlrgitreavieiinrlgipfketniglydlytade
    vfvtgtaaeiapivvidgrkigdgkpgeitrklmeefskltesegvpiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mr0C (C:)
    mlyvymdgefvpeneakvsifdhgflygdgvfegirayngrvfrlkehidrlydsakaid
    leipitkeefmeiiletlrknnlrdayirpivtrgigdlgldprkcqnpsiivitkpwgd
    lyekgltaitvavrrnsfdalppnikslnylnnilakieanakggdeaifldrngyvseg
    sgdnifvvkngaittpptinnlrgitreavieiinrlgipfketniglydlytadevfvt
    gtaaeiapivvidgrkigdgkpgeitrklmeefskltesegvpiye
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5mr0D (D:)
    mlyvymdgefvpeneakvsifdhgflygdgvfegirayngrvfrlkehidrlydsakaid
    leipitkeefmeiiletlrknnlrdayirpivtrgigdlgldprkcqnpsiivitkpwgk
    lygdlyekgltaitvavrrnsfdalppnikslnylnnilakieanakggdeaifldrngy
    vsegsgdnifvvkngaittpptinnlrgitreavieiinrlgipfketniglydlytade
    vfvtgtaaeiapivvidgrkigdgkpgeitrklmeefskltesegvpiye
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5mr0E (E:)
    mlyvymdgefvpeneakvsifdhgflygdgvfegirayngrvfrlkehidrlydsakaid
    leipitkeefmeiiletlrknnlrdayirpivtrgigdlgldprkcqnpsiivitkpwgk
    lygdlyekgltaitvavrrnsfdalppnikslnylnnilakieanakggdeaifldrngy
    vsegsgdnifvvkngaittpptinnlrgitreavieiinrlgipfketniglydlytade
    vfvtgtaaeiapivvidgrkigdgkpgeitrklmeefskltesegvpiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mr0E (E:)
    mlyvymdgefvpeneakvsifdhgflygdgvfegirayngrvfrlkehidrlydsakaid
    leipitkeefmeiiletlrknnlrdayirpivtrgigdlgldprkcqnpsiivitkpwgg
    dlyekgltaitvavrrnsfdalppnikslnylnnilakieanakggdeaifldrngyvse
    gsgdnifvvkngaittpptinnlrgitreavieiinrlgipfketniglydlytadevfv
    tgtaaeiapivvidgrkigdgkpgeitrklmeefskltesegvpiye
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5mr0F (F:)
    mlyvymdgefvpeneakvsifdhgflygdgvfegirayngrvfrlkehidrlydsakaid
    leipitkeefmeiiletlrknnlrdayirpivtrgigdlgldprkcqnpsiivitkpwgk
    lygdlyekgltaitvavrrnsfdalppnikslnylnnilakieanakggdeaifldrngy
    vsegsgdnifvvkngaittpptinnlrgitreavieiinrlgipfketniglydlytade
    vfvtgtaaeiapivvidgrkigdgkpgeitrklmeefskltesegvpiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mr0F (F:)
    mlyvymdgefvpeneakvsifdhgflygdgvfegirayngrvfrlkehidrlydsakaid
    leipitkeefmeiiletlrknnlrdayirpivtrgigdlgldprkcqnpsiivitkpwgg
    dlyekgltaitvavrrnsfdalppnikslnylnnilakieanakggdeaifldrngyvse
    gsgdnifvvkngaittpptinnlrgitreavieiinrlgipfketniglydlytadevfv
    tgtaaeiapivvidgrkigdgkpgeitrklmeefskltesegvpiye