PDB entry 5mp2

View 5mp2 on RCSB PDB site
Description: XcpQN012 in complex with VHH04
Class: transport protein
Keywords: T2SS, secretin, camedlid nanobody, transport protein
Deposited on 2016-12-15, released 2017-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type II secretion system protein D
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: xcpQ1, PAMH19_1963
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Type II secretion system protein D
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: xcpQ1, PAMH19_1963
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Camelid nanobody VHH04
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5MP2
    Domains in SCOPe 2.07: d5mp2c1, d5mp2c2
  • Chain 'D':
    Compound: Camelid nanobody VHH04
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5MP2
    Domains in SCOPe 2.07: d5mp2d1, d5mp2d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5mp2C (C:)
    mkyllptaaagllllaaqpamaqvqlvesgggsvqaggslrlscaasgntdssyymgwfr
    qgpgkeregvasiyiragipyytdsvkgrftisqdnakntiylqmnslkpedtamyfcag
    svrttiqpfkgnyynywgrgtqvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mp2C (C:)
    vqlvesgggsvqaggslrlscaasgntdssyymgwfrqgpgkeregvasiyiragipyyt
    dsvkgrftisqdnakntiylqmnslkpedtamyfcagsvrttiqpfkgnyynywgrgtqv
    tvs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5mp2D (D:)
    mkyllptaaagllllaaqpamaqvqlvesgggsvqaggslrlscaasgntdssyymgwfr
    qgpgkeregvasiyiragipyytdsvkgrftisqdnakntiylqmnslkpedtamyfcag
    svrttiqpfkgnyynywgrgtqvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mp2D (D:)
    qvqlvesgggsvqaggslrlscaasgntdssyymgwfrqgpgkeregvasiyiragipyy
    tdsvkgrftisqdnakntiylqmnslkpedtamyfcagsvrttiqpfkgnyynywgrgtq
    vtvss