PDB entry 5mo9

View 5mo9 on RCSB PDB site
Description: Structure of human TrkB receptor ligand binding domain in complex with the Fab frgment of antibody AB20
Class: immune system
Keywords: Trk receptor, antibody, antigen, complex, immune system
Deposited on 2016-12-14, released 2017-08-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: AB20 Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MO9 (0-End)
  • Chain 'L':
    Compound: AB20 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5MO9 (0-218)
    Domains in SCOPe 2.07: d5mo9l1, d5mo9l2
  • Chain 'X':
    Compound: bdnf/nt-3 growth factors receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NTRK2, TRKB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mo9x_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5mo9L (L:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspnlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqgthvpytfgggtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >5mo9X (X:)
    mgsvnltvhfaptitflesptsdhhwcipftvkgnpkpalqwfyngailneskyictkih
    vtnhteyhgclqldnpthmnngdytliakneygkdekqisahfmgwpgiddganpnypdv
    iyedygtaandigdttnrsneipstdvtdkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mo9X (X:)
    vhfaptitflesptsdhhwcipftvkgnpkpalqwfyngailneskyictkihvtnhtey
    hgclqldnpthmnngdytliakneygkdekqisahfmgwpgi