PDB entry 5mn4

View 5mn4 on RCSB PDB site
Description: S. aureus FtsZ 12-316 F138A GDP Open form (1FOf)
Class: hydrolase
Keywords: bacterial cell division, bacterial cytoskeleton, filamentous, gtpase, hydrolase
Deposited on 2016-12-12, released 2016-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein ftsz
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: ftsZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A031 (0-End)
      • engineered mutation (126)
    Domains in SCOPe 2.07: d5mn4a1, d5mn4a2
  • Heterogens: GDP, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mn4A (A:)
    atlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglga
    ganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgv
    vtrpfsaegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlr
    qgvqgisdliavsgevnldfadvktimsnqgsalmgigvssgenraveaakkaissplle
    tsivgaqgvlmnitggeslslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtvi
    atgfd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mn4A (A:)
    atlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglga
    ganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgv
    vtrpfsaegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlr
    qgvqgisdliavsgevnldfadvktimsnqgsalmgigvssgenraveaakkaissplle
    tsivgaqgvlmnitggeslslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtvi
    atgf