PDB entry 5mlj

View 5mlj on RCSB PDB site
Description: Bromodomain of Human GCN5 with 4-bromo-2-methyl-5-(((3R,5R)-1-methyl-5-phenylpiperidin-3-yl)amino)pyridazin-3(2H)-one
Class: transcription
Keywords: inhibitor, histone, epigenetic reader, bromodomain, gcn5, kat2a, antagonist, transcription
Deposited on 2016-12-06, released 2017-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone acetyltransferase KAT2A
    Species: Homo sapiens [TaxId:9606]
    Gene: KAT2A, GCN5, GCN5L2, HGCN5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mlja_
  • Chain 'B':
    Compound: Histone acetyltransferase KAT2A
    Species: Homo sapiens [TaxId:9606]
    Gene: KAT2A, GCN5, GCN5L2, HGCN5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mljb_
  • Heterogens: EDO, 9ST, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mljA (A:)
    smedpdqlyttlknllaqikshpsawpfmepvkkseapdyyevirfpidlktmterlrsr
    yyvtrklfvadlqrviancreynppdseycrcasalekffyfklkegglidk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mljA (A:)
    dpdqlyttlknllaqikshpsawpfmepvkkseapdyyevirfpidlktmterlrsryyv
    trklfvadlqrviancreynppdseycrcasalekffyfklkegglidk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5mljB (B:)
    smedpdqlyttlknllaqikshpsawpfmepvkkseapdyyevirfpidlktmterlrsr
    yyvtrklfvadlqrviancreynppdseycrcasalekffyfklkegglidk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mljB (B:)
    pdqlyttlknllaqikshpsawpfmepvkkseapdyyevirfpidlktmterlrsryyvt
    rklfvadlqrviancreynppdseycrcasalekffyfklkegg