PDB entry 5ml4

View 5ml4 on RCSB PDB site
Description: The crystal structure of PDE6D in complex to inhibitor-7
Class: lipid binding protein
Keywords: Prenyl binding protein, farnesylated KRas, Plasmam membrane, Arl2, Lipid binding protein
Deposited on 2016-12-06, released 2017-02-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-02-22, with a file datestamp of 2017-02-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE6D, PDED
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5ml4b_
  • Heterogens: RRQ, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5ml4B (B:)
sakderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavsr
elnfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaapesqmmpas
vltgnviietkffdddllvstsrvrlfyv