PDB entry 5mkx

View 5mkx on RCSB PDB site
Description: 1.68A STRUCTURE PCAF BROMODOMAIN WITH 4-chloro-2-methyl-5-(methylamino)pyridazin-3(2H)-one
Class: transcription
Keywords: inhibitor, histone, epigenetic reader, bromodomain, pcaf, antagonist, transcription
Deposited on 2016-12-05, released 2017-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone acetyltransferase KAT2B
    Species: Homo sapiens [TaxId:9606]
    Gene: KAT2B, PCAF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mkxa_
  • Chain 'B':
    Compound: Histone acetyltransferase KAT2B
    Species: Homo sapiens [TaxId:9606]
    Gene: KAT2B, PCAF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mkxb_
  • Heterogens: 82I, SO4, EPE, BU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mkxA (A:)
    smgkekskeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlkt
    mserlknryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglid
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mkxA (A:)
    dqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktmserlknryyvsk
    klfmadlqrvftnckeynppeseyykcanilekfffskikeaglid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5mkxB (B:)
    smgkekskeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlkt
    mserlknryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglid
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mkxB (B:)
    pdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktmserlknryyvs
    kklfmadlqrvftnckeynppeseyykcanilekfffskikeaglid