PDB entry 5mkn

View 5mkn on RCSB PDB site
Description: Crystal structure of SmAP (LSm) protein from Methanococcus vannielii
Class: RNA binding protein
Keywords: Lsm, SmAP, RNA binding protein
Deposited on 2016-12-05, released 2017-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii [TaxId:2187]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mkna_
  • Chain 'B':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii [TaxId:2187]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mknb_
  • Chain 'C':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii [TaxId:2187]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mknc_
  • Chain 'D':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii [TaxId:2187]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mknd_
  • Chain 'E':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii [TaxId:2187]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mkne_
  • Chain 'F':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii [TaxId:2187]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mknf_
  • Chain 'G':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii [TaxId:2187]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mkng_
  • Chain 'H':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii [TaxId:2187]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mknh_
  • Chain 'I':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii [TaxId:2187]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mkni_
  • Chain 'J':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii [TaxId:2187]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mknj_
  • Chain 'K':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii [TaxId:2187]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mknk_
  • Chain 'L':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii [TaxId:2187]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mknl_
  • Chain 'M':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii [TaxId:2187]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mknm_
  • Chain 'N':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii [TaxId:2187]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mknn_
  • Chain 'O':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii [TaxId:2187]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mkno_
  • Chain 'P':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii [TaxId:2187]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mknp_
  • Chain 'Q':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii [TaxId:2187]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mknq_
  • Chain 'R':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii [TaxId:2187]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mknr_
  • Chain 'T':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii [TaxId:2187]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mknt_
  • Chain 'U':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii [TaxId:2187]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mknu_
  • Chain 'V':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii [TaxId:2187]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mknv_
  • Chain 'W':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii [TaxId:2187]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mknw_
  • Chain 'X':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii [TaxId:2187]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mknx_
  • Chain 'Y':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii [TaxId:2187]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mkny_
  • Chain 'Z':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii [TaxId:2187]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mknz_
  • Chain 'a':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii [TaxId:2187]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii [TaxId:2187]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii [TaxId:2187]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed):
  • Heterogens: U5P, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mknA (A:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mknA (A:)
    mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlv
    vrgdnvlyvsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5mknB (B:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mknB (B:)
    mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlv
    vrgdnvlyvsl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5mknC (C:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mknC (C:)
    mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlv
    vrgdnvlyvsl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5mknD (D:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mknD (D:)
    mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlv
    vrgdnvlyvsl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5mknE (E:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mknE (E:)
    mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlv
    vrgdnvlyvsl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5mknF (F:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mknF (F:)
    mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlv
    vrgdnvlyvsl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5mknG (G:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mknG (G:)
    mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiekefpmlvvrgd
    nvlyvsl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5mknH (H:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mknH (H:)
    mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlv
    vrgdnvlyvsl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5mknI (I:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mknI (I:)
    mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlv
    vrgdnvlyvsl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5mknJ (J:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mknJ (J:)
    mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlv
    vrgdnvlyvsl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5mknK (K:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mknK (K:)
    mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlv
    vrgdnvlyvsl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5mknL (L:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mknL (L:)
    mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlv
    vrgdnvlyvsl
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5mknM (M:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mknM (M:)
    mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlv
    vrgdnvlyvsl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5mknN (N:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mknN (N:)
    mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakieeekefpmlvvr
    gdnvlyvsl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5mknO (O:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mknO (O:)
    mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlv
    vrgdnvlyvsl
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5mknP (P:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mknP (P:)
    mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlv
    vrgdnvlyvsl
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >5mknQ (Q:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mknQ (Q:)
    mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlv
    vrgdnvlyvsl
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >5mknR (R:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mknR (R:)
    mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlv
    vrgdnvlyvsl
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >5mknT (T:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mknT (T:)
    mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlv
    vrgdnvlyvsl
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >5mknU (U:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mknU (U:)
    mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakieefpmlvvrgdn
    vlyvsl
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >5mknV (V:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mknV (V:)
    mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlv
    vrgdnvlyvsl
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >5mknW (W:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mknW (W:)
    mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdfpmlvvrgd
    nvlyvsl
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >5mknX (X:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mknX (X:)
    mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlv
    vrgdnvlyvsl
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >5mknY (Y:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mknY (Y:)
    mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakideekefpmlvvr
    gdnvlyvsl
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >5mknZ (Z:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mknZ (Z:)
    mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakieskefpmlvvrg
    dnvlyvsl
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.

  • Chain 'd':
    No sequence available.