PDB entry 5mki

View 5mki on RCSB PDB site
Description: Crystal structure of SmAP (LSm) protein from Methanococcus vannielii
Class: RNA binding protein
Keywords: Lsm, SmAP, RNA binding protein
Deposited on 2016-12-05, released 2017-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii SB [TaxId:406327]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mkia_
  • Chain 'B':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii SB [TaxId:406327]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mkib_
  • Chain 'C':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii SB [TaxId:406327]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mkic_
  • Chain 'D':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii SB [TaxId:406327]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mkid_
  • Chain 'E':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii SB [TaxId:406327]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mkie_
  • Chain 'F':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii SB [TaxId:406327]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mkif_
  • Chain 'G':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii SB [TaxId:406327]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mkig_
  • Chain 'H':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii SB [TaxId:406327]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mkih_
  • Chain 'I':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii SB [TaxId:406327]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mkii_
  • Chain 'J':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii SB [TaxId:406327]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mkij_
  • Chain 'K':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii SB [TaxId:406327]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mkik_
  • Chain 'L':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii SB [TaxId:406327]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mkil_
  • Chain 'M':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii SB [TaxId:406327]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mkim_
  • Chain 'N':
    Compound: Like-Sm ribonucleoprotein core
    Species: Methanococcus vannielii SB [TaxId:406327]
    Gene: Mevan_0470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mkin_
  • Heterogens: CA, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mkiA (A:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mkiA (A:)
    dtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlvv
    rgdnvlyvsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5mkiB (B:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mkiB (B:)
    dtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlvv
    rgdnvlyvsl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5mkiC (C:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mkiC (C:)
    dtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlvv
    rgdnvlyvsl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5mkiD (D:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mkiD (D:)
    dtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakieekefpmlvvrgd
    nvlyvsl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5mkiE (E:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mkiE (E:)
    dtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlvv
    rgdnvlyvsl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5mkiF (F:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mkiF (F:)
    dtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlvv
    rgdnvlyvsl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5mkiG (G:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mkiG (G:)
    dtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlvv
    rgdnvlyvsl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5mkiH (H:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mkiH (H:)
    mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlv
    vrgdnvlyvsl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5mkiI (I:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mkiI (I:)
    dtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlvv
    rgdnvlyvsl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5mkiJ (J:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mkiJ (J:)
    dtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlvv
    rgdnvlyvsl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5mkiK (K:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mkiK (K:)
    dtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlvv
    rgdnvlyvsl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5mkiL (L:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mkiL (L:)
    dtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlvv
    rgdnvlyvsl
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5mkiM (M:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mkiM (M:)
    dtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlvv
    rgdnvlyvsl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5mkiN (N:)
    mmdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpml
    vvrgdnvlyvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mkiN (N:)
    dtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesefpmlvvrgdn
    vlyvsl