PDB entry 5mii

View 5mii on RCSB PDB site
Description: Crystal structure of carboxyl esterase 2 (TmelEST2) from mycorrhizal fungus Tuber melanosporum
Class: hydrolase
Keywords: lipase alpha/beta hydrolase fold archaebacterial-like enzymes PMSF, hydrolase
Deposited on 2016-11-28, released 2017-08-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carboxyl esterase 2
    Species: Tuber melanosporum (strain Mel28) [TaxId:656061]
    Gene: GSTUM_00003552001
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5miia_
  • Chain 'B':
    Compound: Carboxyl esterase 2
    Species: Tuber melanosporum (strain Mel28) [TaxId:656061]
    Gene: GSTUM_00003552001
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5miib_
  • Chain 'C':
    Compound: Carboxyl esterase 2
    Species: Tuber melanosporum (strain Mel28) [TaxId:656061]
    Gene: GSTUM_00003552001
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5miic_
  • Chain 'D':
    Compound: Carboxyl esterase 2
    Species: Tuber melanosporum (strain Mel28) [TaxId:656061]
    Gene: GSTUM_00003552001
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5miid_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5miiA (A:)
    mrftilsvlafslplvlaetpapscpvtnvttpqldpitqayadaissrpslfafplpei
    rdgyqsnvsdpstefttkilslpvgptgnvtaylykpvsgerekgkdllpviayfhgggw
    vfggpksyrglitnliresgaavffvdytltpkvaypvpneqcyaavqwllehgeklgvd
    ptnmgfggdsaggelsssvsllsikrktplpkfqvliypatdlacesatfkefpngpglt
    tdeirfaaslftpdpksrledvaspgrasdedlakfpetlivvaevdpirqqgedfgrrl
    qklgvraaiirvlgtihgfasidvlseapgakatieligykfkkalh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5miiA (A:)
    qldpitqayadaissrpslfafplpeirdgyqsnvsdpstefttkilslpvgptgnvtay
    lykpvsdllpviayfhgggwvfggpksyrglitnliresgaavffvdytltpkvaypvpn
    eqcyaavqwllehgeklgvdptnmgfggdsaggelsssvsllsikrktplpkfqvliypa
    tdlacesatfkefpngpglttdeirfaaslftpdpksrledvaspgrasdedlakfpetl
    ivvaevdpirqqgedfgrrlqklgvraaiirvlgtihgfasidvlseapgakatieligy
    kfkkalh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5miiB (B:)
    mrftilsvlafslplvlaetpapscpvtnvttpqldpitqayadaissrpslfafplpei
    rdgyqsnvsdpstefttkilslpvgptgnvtaylykpvsgerekgkdllpviayfhgggw
    vfggpksyrglitnliresgaavffvdytltpkvaypvpneqcyaavqwllehgeklgvd
    ptnmgfggdsaggelsssvsllsikrktplpkfqvliypatdlacesatfkefpngpglt
    tdeirfaaslftpdpksrledvaspgrasdedlakfpetlivvaevdpirqqgedfgrrl
    qklgvraaiirvlgtihgfasidvlseapgakatieligykfkkalh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5miiB (B:)
    qldpitqayadaissrpslfafplpeirdgyqsnvsdpstefttkilslpvgptgnvtay
    lykpvsdllpviayfhgggwvfggpksyrglitnliresgaavffvdytltpkvaypvpn
    eqcyaavqwllehgeklgvdptnmgfggdsaggelsssvsllsikrktplpkfqvliypa
    tdlacesatfkefpngpglttdeirfaaslftpdpksrledvaspgrasdedlakfpetl
    ivvaevdpirqqgedfgrrlqklgvraaiirvlgtihgfasidvlseapgakatieligy
    kfkkalh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5miiC (C:)
    mrftilsvlafslplvlaetpapscpvtnvttpqldpitqayadaissrpslfafplpei
    rdgyqsnvsdpstefttkilslpvgptgnvtaylykpvsgerekgkdllpviayfhgggw
    vfggpksyrglitnliresgaavffvdytltpkvaypvpneqcyaavqwllehgeklgvd
    ptnmgfggdsaggelsssvsllsikrktplpkfqvliypatdlacesatfkefpngpglt
    tdeirfaaslftpdpksrledvaspgrasdedlakfpetlivvaevdpirqqgedfgrrl
    qklgvraaiirvlgtihgfasidvlseapgakatieligykfkkalh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5miiC (C:)
    qldpitqayadaissrpslfafplpeirdgyqsnvstefttkilslpvgptgnvtaylyk
    pvdllpviayfhgggwvfggpksyrglitnliresgaavffvdytltpkvaypvpneqcy
    aavqwllehgeklgvdptnmgfggdsaggelsssvsllsikrktplpkfqvliypatdla
    cesatfkefpngpglttdeirfaaslftpdpksrledvaspgrasdedlakfpetlivva
    evdpirqqgedfgrrlqklgvraaiirvlgtihgfasidvlseapgakatieligykfkk
    alh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5miiD (D:)
    mrftilsvlafslplvlaetpapscpvtnvttpqldpitqayadaissrpslfafplpei
    rdgyqsnvsdpstefttkilslpvgptgnvtaylykpvsgerekgkdllpviayfhgggw
    vfggpksyrglitnliresgaavffvdytltpkvaypvpneqcyaavqwllehgeklgvd
    ptnmgfggdsaggelsssvsllsikrktplpkfqvliypatdlacesatfkefpngpglt
    tdeirfaaslftpdpksrledvaspgrasdedlakfpetlivvaevdpirqqgedfgrrl
    qklgvraaiirvlgtihgfasidvlseapgakatieligykfkkalh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5miiD (D:)
    qldpitqayadaissrpslfafplpeirdgyqsnvsdpstefttkilslpvgptgnvtay
    lykpvsdllpviayfhgggwvfggpksyrglitnliresgaavffvdytltpkvaypvpn
    eqcyaavqwllehgeklgvdptnmgfggdsaggelsssvsllsikrktplpkfqvliypa
    tdlacesatfkefpngpglttdeirfaaslftpdpksrledvaspgrasdedlakfpetl
    ivvaevdpirqqgedfgrrlqklgvraaiirvlgtihgfasidvlseapgakatieligy
    kfkkalh