PDB entry 5mi3

View 5mi3 on RCSB PDB site
Description: Structure of phosphorylated translation elongation factor EF-Tu from E. coli
Class: hydrolase
Keywords: translation elongation, EF-Tu, phosphorylation, nucleotide binding, protein dynamics, conformational cycle, toxin-antitoxin, TOXIN, hydrolase
Deposited on 2016-11-27, released 2017-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor Tu 1
    Species: Escherichia coli O9:H4 (strain HS) [TaxId:331112]
    Gene: tuf1, EcHS_A3535
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mi3a1, d5mi3a2, d5mi3a3
  • Chain 'B':
    Compound: Elongation factor Tu 1
    Species: Escherichia coli O9:H4 (strain HS) [TaxId:331112]
    Gene: tuf1, EcHS_A3535
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mi3b1, d5mi3b2, d5mi3b3
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mi3A (A:)
    mgshhhhhhskekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidn
    apeekargitintshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgp
    mpqtrehillgrqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivr
    gsalkalegdaeweakilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrv
    ergiikvgeeveivgiketqkstctgvemfrklldegragenvgvllrgikreeiergqv
    lakpgtikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvm
    pgdnikmvvtlihpiamddglrfaireggrtvgagvvakvlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mi3A (A:)
    tkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshv
    eydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgv
    pyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweak
    ilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgi
    ketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikphtkfese
    vyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvvtlihpia
    mddglrfaireggrtvgagvvakvlg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5mi3B (B:)
    mgshhhhhhskekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidn
    apeekargitintshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgp
    mpqtrehillgrqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivr
    gsalkalegdaeweakilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrv
    ergiikvgeeveivgiketqkstctgvemfrklldegragenvgvllrgikreeiergqv
    lakpgtikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvm
    pgdnikmvvtlihpiamddglrfaireggrtvgagvvakvlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mi3B (B:)
    tkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshv
    eydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgv
    pyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweak
    ilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgi
    ketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikphtkfese
    vyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvvtlihpia
    mddglrfaireggrtvgagvvakvlg