PDB entry 5mhq

View 5mhq on RCSB PDB site
Description: CCT068127 in complex with CDK2
Class: cell cycle/inhibitor
Keywords: CELL CYCLE, INHIBITOR, CDK2, CDK9, CELL CYCLE-INHIBITOR complex
Deposited on 2016-11-25, released 2017-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-dependent kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK2, CDKN2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24941 (8-305)
      • expression tag (5-7)
    Domains in SCOPe 2.07: d5mhqa1, d5mhqa2
  • Heterogens: 8QT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mhqA (A:)
    gplgspefmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstairei
    sllkelnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqll
    qglafchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrape
    illgckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvts
    mpdykpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkp
    vphlrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mhqA (A:)
    pefmenfqkvekigegtygvvykarnkltgevvalkkirltaireisllkelnhpnivkl
    ldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchshrvlhr
    dlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyystavdi
    wslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsfpkwarq
    dfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlrl