PDB entry 5mgt

View 5mgt on RCSB PDB site
Description: Complex of human NKR-P1 and LLT1 in deglycosylated forms
Class: immune system
Keywords: receptor, CTL fold, natural killer cell, immune system, receptor-ligand complex
Deposited on 2016-11-22, released 2018-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin domain family 2 member D
    Species: Homo sapiens [TaxId:9606]
    Gene: CLEC2D, CLAX, LLT1, OCIL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UHP7
      • engineered mutation (107)
    Domains in SCOPe 2.07: d5mgta_
  • Chain 'B':
    Compound: C-type lectin domain family 2 member D
    Species: Homo sapiens [TaxId:9606]
    Gene: CLEC2D, CLAX, LLT1, OCIL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UHP7
      • engineered mutation (107)
    Domains in SCOPe 2.07: d5mgtb_
  • Chain 'C':
    Compound: Killer cell lectin-like receptor subfamily B member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KLRB1, CLEC5B, NKRP1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12918 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d5mgtc1, d5mgtc2
  • Chain 'D':
    Compound: Killer cell lectin-like receptor subfamily B member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KLRB1, CLEC5B, NKRP1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mgtd_
  • Chain 'E':
    Compound: Killer cell lectin-like receptor subfamily B member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KLRB1, CLEC5B, NKRP1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mgte_
  • Chain 'F':
    Compound: Killer cell lectin-like receptor subfamily B member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KLRB1, CLEC5B, NKRP1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mgtf_
  • Heterogens: NAG, SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mgtA (A:)
    itgqaacpeswigfqrkcfyfsddtknwtssqrfcdsqdadlaqvesfqelnfllrykgp
    sdhwiglsreqgqpwkwingtewtrqfpilgagecaylndkgassarcyterkwicsksd
    ihvgtkhhhhhhhhg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mgtA (A:)
    aacpeswigfqrkcfyfsddtknwtssqrfcdsqdadlaqvesfqelnfllrykgpsdhw
    iglsreqgqpwkwingtewtrqfpilgagecaylndkgassarcyterkwicsksd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5mgtB (B:)
    itgqaacpeswigfqrkcfyfsddtknwtssqrfcdsqdadlaqvesfqelnfllrykgp
    sdhwiglsreqgqpwkwingtewtrqfpilgagecaylndkgassarcyterkwicsksd
    ihvgtkhhhhhhhhg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mgtB (B:)
    acpeswigfqrkcfyfsddtknwtssqrfcdsqdadlaqvesfqelnfllrykgpsdhwi
    glsreqgqpwkwingtewtrqfpilgagecaylndkgassarcyterkwicsksdi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5mgtC (C:)
    etggllncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlir
    dkailfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycstei
    rwicqkeltpvrnkvypdskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mgtC (C:)
    ggllncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlirdk
    ailfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycsteirw
    icqkelt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5mgtD (D:)
    etggllncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlir
    dkailfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycstei
    rwicqkeltpvrnkvypdskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mgtD (D:)
    llncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlirdkai
    lfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycsteirwic
    qkelt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5mgtE (E:)
    etggllncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlir
    dkailfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycstei
    rwicqkeltpvrnkvypdskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mgtE (E:)
    gllncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlirdka
    ilfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycsteirwi
    cqkelt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5mgtF (F:)
    etggllncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlir
    dkailfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycstei
    rwicqkeltpvrnkvypdskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mgtF (F:)
    llncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlirdkai
    lfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycsteirwic
    qkelt