PDB entry 5mgs

View 5mgs on RCSB PDB site
Description: Human receptor NKR-P1 in deglycosylated form, extracellular domain
Class: immune system
Keywords: receptor, CTL fold, natural killer cell, Immune system
Deposited on 2016-11-22, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Killer cell lectin-like receptor subfamily B member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KLRB1, CLEC5B, NKRP1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mgsa_
  • Chain 'B':
    Compound: Killer cell lectin-like receptor subfamily B member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KLRB1, CLEC5B, NKRP1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mgsb_
  • Chain 'C':
    Compound: Killer cell lectin-like receptor subfamily B member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KLRB1, CLEC5B, NKRP1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mgsc_
  • Chain 'D':
    Compound: Killer cell lectin-like receptor subfamily B member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KLRB1, CLEC5B, NKRP1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mgsd_
  • Chain 'E':
    Compound: Killer cell lectin-like receptor subfamily B member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KLRB1, CLEC5B, NKRP1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mgse_
  • Chain 'F':
    Compound: Killer cell lectin-like receptor subfamily B member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KLRB1, CLEC5B, NKRP1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mgsf_
  • Chain 'G':
    Compound: Killer cell lectin-like receptor subfamily B member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KLRB1, CLEC5B, NKRP1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mgsg_
  • Chain 'H':
    Compound: Killer cell lectin-like receptor subfamily B member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KLRB1, CLEC5B, NKRP1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mgsh_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mgsA (A:)
    etggllncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlir
    dkailfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycstei
    rwicqkeltpvrnkvypdskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mgsA (A:)
    llncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlirdkai
    lfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycsteirwic
    qkel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5mgsB (B:)
    etggllncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlir
    dkailfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycstei
    rwicqkeltpvrnkvypdskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mgsB (B:)
    gllncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlirdka
    ilfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycsteirwi
    cqkeltpv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5mgsC (C:)
    etggllncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlir
    dkailfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycstei
    rwicqkeltpvrnkvypdskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mgsC (C:)
    llncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlirdkai
    lfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycsteirwic
    qkeltp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5mgsD (D:)
    etggllncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlir
    dkailfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycstei
    rwicqkeltpvrnkvypdskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mgsD (D:)
    gllncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlirdka
    ilfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycsteirwi
    cqkel
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5mgsE (E:)
    etggllncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlir
    dkailfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycstei
    rwicqkeltpvrnkvypdskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mgsE (E:)
    gllncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlirdka
    ilfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycsteirwi
    cqkel
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5mgsF (F:)
    etggllncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlir
    dkailfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycstei
    rwicqkeltpvrnkvypdskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mgsF (F:)
    llncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlirdkai
    lfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycsteirwic
    qkel
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5mgsG (G:)
    etggllncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlir
    dkailfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycstei
    rwicqkeltpvrnkvypdskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mgsG (G:)
    llncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlirdkai
    lfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycsteirwic
    qkel
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5mgsH (H:)
    etggllncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlir
    dkailfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycstei
    rwicqkeltpvrnkvypdskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mgsH (H:)
    gllncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlirdka
    ilfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycsteirwi
    cqkeltpvr