PDB entry 5mgr

View 5mgr on RCSB PDB site
Description: Human receptor NKR-P1 in glycosylated form, extracellular domain
Class: immune system
Keywords: receptor, CTL fold, natural killer cell, Immune system
Deposited on 2016-11-22, released 2018-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Killer cell lectin-like receptor subfamily B member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KLRB1, CLEC5B, NKRP1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mgra_
  • Chain 'B':
    Compound: Killer cell lectin-like receptor subfamily B member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KLRB1, CLEC5B, NKRP1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mgrb_
  • Heterogens: NAG, BMA, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mgrA (A:)
    etggllncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlir
    dkailfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycstei
    rwicqkeltpvrnkvypdskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mgrA (A:)
    gllncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlirdka
    ilfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycsteirwi
    cqkel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5mgrB (B:)
    etggllncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlir
    dkailfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycstei
    rwicqkeltpvrnkvypdskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mgrB (B:)
    gllncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlirdka
    ilfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycsteirwi
    cqkel