PDB entry 5mgg

View 5mgg on RCSB PDB site
Description: Crystal Structure of BAZ2B bromodomain in complex with 4-chloropyridine derivative 3
Class: transcription
Keywords: four helical bundle, transcription
Deposited on 2016-11-21, released 2017-04-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain adjacent to zinc finger domain protein 2B
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2B, KIAA1476
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIF8 (2-115)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d5mgga1, d5mgga2
  • Heterogens: 7MU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5mggA (A:)
    smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
    eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfkv