PDB entry 5mdm

View 5mdm on RCSB PDB site
Description: Structural intermediates in the fusion associated transition of vesiculovirus glycoprotein
Class: viral protein
Keywords: Class III viral fusion glycoprotein, viral protein
Deposited on 2016-11-11, released 2016-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycoprotein
    Species: Chandipura virus [TaxId:11272]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mdma_
  • Chain 'C':
    Compound: Glycoprotein
    Species: Chandipura virus [TaxId:11272]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mdmc_
  • Chain 'E':
    Compound: Glycoprotein
    Species: Chandipura virus [TaxId:11272]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mdme_
  • Chain 'F':
    Compound: Glycoprotein
    Species: Chandipura virus [TaxId:11272]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mdmf_
  • Heterogens: SO4, NAG, FUC

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mdmA (A:)
    ylsiafpentkldwkpvtkntrycpmggewflepglqeesflsstpigatpsksdgflch
    aakwvttcdfrwygpkyithsihnikptrsdcdtalasyksgtlvslgfppescgyasvt
    dseflvimitphhvgvddyrghwvdplfvggecdqsycdtihnssvwipadqtkknicgq
    sftpltvtvaydktkeiaaggivfkskyhshmegartcrlsycgrngikfpngewvsldv
    ktriqekhllplfkecpagtevrstlqsdgaqvltseiqrildyslcqntwdkverkepl
    spldlsylaskspgkglaytvingtlsfahtryvrmwidgpvlkepkgkrespsgissdi
    wtqwfkygdmeigpngllktaggykfpwhligmgivdnelhelseanpldhpqlphaqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mdmA (A:)
    ylsiafpentkldwkpvtkntrycpmggewflepglqeesflsstpigatpsksdgflch
    aakwvttcdfrwygpkyithsihnikptrsdcdtalasyksgtlvslgfppescgyasvt
    dseflvimitphhvgvddyrghwvdplfvggecdqsycdtihnssvwipadqtkknicgq
    sftpltvtvaydktkeiaaggivfkskyhshmegartcrlsycgrngikfpngewvsldv
    ktriqekhllplfkecpagtevrstlqsdgaqvltseiqrildyslcqntwdkverkepl
    spldlsylaskspgkglaytvingtlsfahtryvrmwidgpvlkepkgkrespsgissdi
    wtqwfkygdmeigpngllktaggykfpwhligmgivdnelhelseanpld
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5mdmC (C:)
    ylsiafpentkldwkpvtkntrycpmggewflepglqeesflsstpigatpsksdgflch
    aakwvttcdfrwygpkyithsihnikptrsdcdtalasyksgtlvslgfppescgyasvt
    dseflvimitphhvgvddyrghwvdplfvggecdqsycdtihnssvwipadqtkknicgq
    sftpltvtvaydktkeiaaggivfkskyhshmegartcrlsycgrngikfpngewvsldv
    ktriqekhllplfkecpagtevrstlqsdgaqvltseiqrildyslcqntwdkverkepl
    spldlsylaskspgkglaytvingtlsfahtryvrmwidgpvlkepkgkrespsgissdi
    wtqwfkygdmeigpngllktaggykfpwhligmgivdnelhelseanpldhpqlphaqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mdmC (C:)
    ylsiafpentkldwkpvtkntrycpmggewflepglqeesflsstpigatpsksdgflch
    aakwvttcdfrwygpkyithsihnikptrsdcdtalasyksgtlvslgfppescgyasvt
    dseflvimitphhvgvddyrghwvdplfvggecdqsycdtihnssvwipadqtkknicgq
    sftpltvtvaydktkeiaaggivfkskyhshmegartcrlsycgrngikfpngewvsldv
    ktriqekhllplfkecpagtevrstlqsaqvltseiqrildyslcqntwdkverkeplsp
    ldlsylaskspgkglaytvingtlsfahtryvrmwidgpvlkepkgkrespsgissdiwt
    qwfkygdmeigpngllktaggykfpwhligmelhelse
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5mdmE (E:)
    ylsiafpentkldwkpvtkntrycpmggewflepglqeesflsstpigatpsksdgflch
    aakwvttcdfrwygpkyithsihnikptrsdcdtalasyksgtlvslgfppescgyasvt
    dseflvimitphhvgvddyrghwvdplfvggecdqsycdtihnssvwipadqtkknicgq
    sftpltvtvaydktkeiaaggivfkskyhshmegartcrlsycgrngikfpngewvsldv
    ktriqekhllplfkecpagtevrstlqsdgaqvltseiqrildyslcqntwdkverkepl
    spldlsylaskspgkglaytvingtlsfahtryvrmwidgpvlkepkgkrespsgissdi
    wtqwfkygdmeigpngllktaggykfpwhligmgivdnelhelseanpldhpqlphaqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mdmE (E:)
    ylsiafpentkldwkpvtkntrycpmggewflepglqeesflsstpigatpsksdgflch
    aakwvttcdfrwygpkyithsihnikptrsdcdtalasyksgtlvslgfppescgyasvt
    dseflvimitphhvgvddyrghwvdplfvggecdqsycdtihnssvwipadqtkknicgq
    sftpltvtvaydktkeiaaggivfkskyhshmegartcrlsycgrngikfpngewvsldv
    ktriqekhllplfkecpagtevrstlqsdgaqvltseiqrildyslcqntwdkverkepl
    spldlsylaskspgkglaytvingtlsfahtryvrmwidgpvlkepkgkrespsgissdi
    wtqwfkygdmeigpngllktaggykfpwhligmgivdnelhelseanpld
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5mdmF (F:)
    ylsiafpentkldwkpvtkntrycpmggewflepglqeesflsstpigatpsksdgflch
    aakwvttcdfrwygpkyithsihnikptrsdcdtalasyksgtlvslgfppescgyasvt
    dseflvimitphhvgvddyrghwvdplfvggecdqsycdtihnssvwipadqtkknicgq
    sftpltvtvaydktkeiaaggivfkskyhshmegartcrlsycgrngikfpngewvsldv
    ktriqekhllplfkecpagtevrstlqsdgaqvltseiqrildyslcqntwdkverkepl
    spldlsylaskspgkglaytvingtlsfahtryvrmwidgpvlkepkgkrespsgissdi
    wtqwfkygdmeigpngllktaggykfpwhligmgivdnelhelseanpldhpqlphaqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mdmF (F:)
    ylsiafpentkldwkpvtkntrycpmggewflepglqeesflsstpigatpsksdgflch
    aakwvttcdfrwygpkyithsihnikptrsdcdtalasyksgtlvslgfppescgyasvt
    dseflvimitphhvgvddyrghwvdplfvggecdqsycdtihnssvwipadqtkknicgq
    sftpltvtvaydktkeiaaggivfkskyhshmegartcrlsycgrngikfpngewvsldv
    ktriqekhllplfkecpagtevrstlqsaqvltseiqrildyslcqntwdkverkeplsp
    ldlsylaskspgkglaytvingtlsfahtryvrmwidgpvlkepkgkrespsgissdiwt
    qwfkygdmeigpngllktaggykfpwhligmelhelse