PDB entry 5mba

View 5mba on RCSB PDB site
Description: binding mode of azide to ferric aplysia limacina myoglobin. crystallographic analysis at 1.9 angstroms resolution
Deposited on 1991-01-14, released 1992-07-15
The last revision prior to the SCOP 1.57 freeze date was dated 1992-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.139
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d5mba__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5mba_ (-)
    slsaaeadlagkswapvfanknangldflvalfekfpdsanffadfkgksvadikaspkl
    rdvssriftrlnefvnnaanagkmsamlsqfakehvgfgvgsaqfenvrsmfpgfvasva
    appagadaawtklfgliidalkaaga