PDB entry 5mac

View 5mac on RCSB PDB site
Description: Crystal structure of decameric Methanococcoides burtonii Rubisco complexed with 2-carboxyarabinitol bisphosphate
Class: lyase
Keywords: Lyase, Archaea, Rubisco, Decamer
Deposited on 2016-11-03, released 2017-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-03, with a file datestamp of 2017-04-28.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribulose-1,5-bisphosphate carboxylase-oxygenase type III
    Species: Methanococcoides burtonii [TaxId:29291]
    Gene: Mbur_2322
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5maca1, d5maca2
  • Chain 'B':
    Compound: Ribulose-1,5-bisphosphate carboxylase-oxygenase type III
    Species: Methanococcoides burtonii [TaxId:29291]
    Gene: Mbur_2322
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5macb1, d5macb2
  • Chain 'C':
    Compound: Ribulose-1,5-bisphosphate carboxylase-oxygenase type III
    Species: Methanococcoides burtonii [TaxId:29291]
    Gene: Mbur_2322
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5macc1, d5macc2
  • Chain 'D':
    Compound: Ribulose-1,5-bisphosphate carboxylase-oxygenase type III
    Species: Methanococcoides burtonii [TaxId:29291]
    Gene: Mbur_2322
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5macd1, d5macd2
  • Chain 'E':
    Compound: Ribulose-1,5-bisphosphate carboxylase-oxygenase type III
    Species: Methanococcoides burtonii [TaxId:29291]
    Gene: Mbur_2322
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5mace1, d5mace2
  • Heterogens: CAP, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5macA (A:)
    msliyedlvksldskqqayvdlklpdptngefllavfhmipggdlnvlqaaaeiaaesst
    gtnikvstetafsrtmnarvyqldlerelvwiaypwrlfdrggnvqniltyiignilgmk
    eiqalklmdiwfppsmleqydgpsytvddmrkyldvydrpilgtivkpkmgltsaeyaev
    cydfwvgggdfvkndepqanqdfcpyekmvahvkeamdkavketgqkkvhsfnvsaadfd
    tmiercemitnagfepgsyaflidgitagwmavqtlrrrypdvflhfhraahgaftrqen
    pigfsvlvlskfarlagasgihtgtagigkmkgtpaedvvaahsiqylkspghffeqtws
    kimdtdkdvinlvnedlahhvileddswramkkccpivsgglnpvklkpfidvmenvdfi
    ttmgsgvhshpggtqsgakalvqacdaylqgmdieeyakdhkelaeaiefylnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5macA (A:)
    msliyedlvksldskqqayvdlklpdptngefllavfhmipggdlnvlqaaaeiaaesst
    gtnikvstetafsrtmnarvyqldlerelvwiaypwrlfdrggnvqniltyiignilgmk
    eiqalklmdiwfppsmleqydgpsytvddmrkyldvydrpilgtivkpkmgltsaeyaev
    cydfwvgggdfvkndepqanqdfcpyekmvahvkeamdkavketgqkkvhsfnvsaadfd
    tmiercemitnagfepgsyaflidgitagwmavqtlrrrypdvflhfhraahgaftrqen
    pigfsvlvlskfarlagasgihtgtagigkmkgtpaedvvaahsiqylkspghffeqtws
    kimdtdkdvinlvnedlahhvileddswramkkccpivsgglnpvklkpfidvmenvdfi
    ttmgsgvhshpggtqsgakalvqacdaylqgmdieeyakdhkelaeaiefyln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5macB (B:)
    msliyedlvksldskqqayvdlklpdptngefllavfhmipggdlnvlqaaaeiaaesst
    gtnikvstetafsrtmnarvyqldlerelvwiaypwrlfdrggnvqniltyiignilgmk
    eiqalklmdiwfppsmleqydgpsytvddmrkyldvydrpilgtivkpkmgltsaeyaev
    cydfwvgggdfvkndepqanqdfcpyekmvahvkeamdkavketgqkkvhsfnvsaadfd
    tmiercemitnagfepgsyaflidgitagwmavqtlrrrypdvflhfhraahgaftrqen
    pigfsvlvlskfarlagasgihtgtagigkmkgtpaedvvaahsiqylkspghffeqtws
    kimdtdkdvinlvnedlahhvileddswramkkccpivsgglnpvklkpfidvmenvdfi
    ttmgsgvhshpggtqsgakalvqacdaylqgmdieeyakdhkelaeaiefylnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5macB (B:)
    msliyedlvksldskqqayvdlklpdptngefllavfhmipggdlnvlqaaaeiaaesst
    gtnikvstetafsrtmnarvyqldlerelvwiaypwrlfdrggnvqniltyiignilgmk
    eiqalklmdiwfppsmleqydgpsytvddmrkyldvydrpilgtivkpkmgltsaeyaev
    cydfwvgggdfvkndepqanqdfcpyekmvahvkeamdkavketgqkkvhsfnvsaadfd
    tmiercemitnagfepgsyaflidgitagwmavqtlrrrypdvflhfhraahgaftrqen
    pigfsvlvlskfarlagasgihtgtagigkmkgtpaedvvaahsiqylkspghffeqtws
    kimdtdkdvinlvnedlahhvileddswramkkccpivsgglnpvklkpfidvmenvdfi
    ttmgsgvhshpggtqsgakalvqacdaylqgmdieeyakdhkelaeaiefyln
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5macC (C:)
    msliyedlvksldskqqayvdlklpdptngefllavfhmipggdlnvlqaaaeiaaesst
    gtnikvstetafsrtmnarvyqldlerelvwiaypwrlfdrggnvqniltyiignilgmk
    eiqalklmdiwfppsmleqydgpsytvddmrkyldvydrpilgtivkpkmgltsaeyaev
    cydfwvgggdfvkndepqanqdfcpyekmvahvkeamdkavketgqkkvhsfnvsaadfd
    tmiercemitnagfepgsyaflidgitagwmavqtlrrrypdvflhfhraahgaftrqen
    pigfsvlvlskfarlagasgihtgtagigkmkgtpaedvvaahsiqylkspghffeqtws
    kimdtdkdvinlvnedlahhvileddswramkkccpivsgglnpvklkpfidvmenvdfi
    ttmgsgvhshpggtqsgakalvqacdaylqgmdieeyakdhkelaeaiefylnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5macC (C:)
    msliyedlvksldskqqayvdlklpdptngefllavfhmipggdlnvlqaaaeiaaesst
    gtnikvstetafsrtmnarvyqldlerelvwiaypwrlfdrggnvqniltyiignilgmk
    eiqalklmdiwfppsmleqydgpsytvddmrkyldvydrpilgtivkpkmgltsaeyaev
    cydfwvgggdfvkndepqanqdfcpyekmvahvkeamdkavketgqkkvhsfnvsaadfd
    tmiercemitnagfepgsyaflidgitagwmavqtlrrrypdvflhfhraahgaftrqen
    pigfsvlvlskfarlagasgihtgtagigkmkgtpaedvvaahsiqylkspghffeqtws
    kimdtdkdvinlvnedlahhvileddswramkkccpivsgglnpvklkpfidvmenvdfi
    ttmgsgvhshpggtqsgakalvqacdaylqgmdieeyakdhkelaeaiefyl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5macD (D:)
    msliyedlvksldskqqayvdlklpdptngefllavfhmipggdlnvlqaaaeiaaesst
    gtnikvstetafsrtmnarvyqldlerelvwiaypwrlfdrggnvqniltyiignilgmk
    eiqalklmdiwfppsmleqydgpsytvddmrkyldvydrpilgtivkpkmgltsaeyaev
    cydfwvgggdfvkndepqanqdfcpyekmvahvkeamdkavketgqkkvhsfnvsaadfd
    tmiercemitnagfepgsyaflidgitagwmavqtlrrrypdvflhfhraahgaftrqen
    pigfsvlvlskfarlagasgihtgtagigkmkgtpaedvvaahsiqylkspghffeqtws
    kimdtdkdvinlvnedlahhvileddswramkkccpivsgglnpvklkpfidvmenvdfi
    ttmgsgvhshpggtqsgakalvqacdaylqgmdieeyakdhkelaeaiefylnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5macD (D:)
    msliyedlvksldskqqayvdlklpdptngefllavfhmipggdlnvlqaaaeiaaesst
    gtnikvstetafsrtmnarvyqldlerelvwiaypwrlfdrggnvqniltyiignilgmk
    eiqalklmdiwfppsmleqydgpsytvddmrkyldvydrpilgtivkpkmgltsaeyaev
    cydfwvgggdfvkndepqanqdfcpyekmvahvkeamdkavketgqkkvhsfnvsaadfd
    tmiercemitnagfepgsyaflidgitagwmavqtlrrrypdvflhfhraahgaftrqen
    pigfsvlvlskfarlagasgihtgtagigkmkgtpaedvvaahsiqylkspghffeqtws
    kimdtdkdvinlvnedlahhvileddswramkkccpivsgglnpvklkpfidvmenvdfi
    ttmgsgvhshpggtqsgakalvqacdaylqgmdieeyakdhkelaeaiefyln
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5macE (E:)
    msliyedlvksldskqqayvdlklpdptngefllavfhmipggdlnvlqaaaeiaaesst
    gtnikvstetafsrtmnarvyqldlerelvwiaypwrlfdrggnvqniltyiignilgmk
    eiqalklmdiwfppsmleqydgpsytvddmrkyldvydrpilgtivkpkmgltsaeyaev
    cydfwvgggdfvkndepqanqdfcpyekmvahvkeamdkavketgqkkvhsfnvsaadfd
    tmiercemitnagfepgsyaflidgitagwmavqtlrrrypdvflhfhraahgaftrqen
    pigfsvlvlskfarlagasgihtgtagigkmkgtpaedvvaahsiqylkspghffeqtws
    kimdtdkdvinlvnedlahhvileddswramkkccpivsgglnpvklkpfidvmenvdfi
    ttmgsgvhshpggtqsgakalvqacdaylqgmdieeyakdhkelaeaiefylnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5macE (E:)
    sliyedlvksldskqqayvdlklpdptngefllavfhmipggdlnvlqaaaeiaaesstg
    tnikvstetafsrtmnarvyqldlerelvwiaypwrlfdrggnvqniltyiignilgmke
    iqalklmdiwfppsmleqydgpsytvddmrkyldvydrpilgtivkpkmgltsaeyaevc
    ydfwvgggdfvkndepqanqdfcpyekmvahvkeamdkavketgqkkvhsfnvsaadfdt
    miercemitnagfepgsyaflidgitagwmavqtlrrrypdvflhfhraahgaftrqenp
    igfsvlvlskfarlagasgihtgtagigkmkgtpaedvvaahsiqylkspghffeqtwsk
    imdtdkdvinlvnedlahhvileddswramkkccpivsgglnpvklkpfidvmenvdfit
    tmgsgvhshpggtqsgakalvqacdaylqgmdieeyakdhkelaeaiefyln