PDB entry 5m96

View 5m96 on RCSB PDB site
Description: Synthesis and biological evaluation of new triazolo and imidazolopyridine RORgt inverse agonists
Class: transcription
Keywords: nuclear hormone receptor, ligand-binding domain, inverse agonist, transcription
Deposited on 2016-10-31, released 2016-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449
      • engineered mutation (193)
    Domains in SCOPe 2.07: d5m96a_
  • Chain 'B':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449
      • engineered mutation (193)
    Domains in SCOPe 2.07: d5m96b_
  • Heterogens: Q6Y, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5m96A (A:)
    gpyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerca
    hhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegk
    yggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveq
    lqynlelafhhhlskthrqsilaklppkgklrslcsqhverlqifqhlhp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m96A (A:)
    aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
    teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
    melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
    nlelafhhhlskthrqsilaklppkgklrslcsqhverlqifqhl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5m96B (B:)
    gpyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerca
    hhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegk
    yggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveq
    lqynlelafhhhlskthrqsilaklppkgklrslcsqhverlqifqhlhp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m96B (B:)
    aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
    teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
    melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
    nlelafhhhlskthrqsilaklppkgklrslcsqhverlqifq