PDB entry 5m93

View 5m93 on RCSB PDB site
Description: Crystal structure of SdeA-modified ubiquitin.
Class: signaling protein
Keywords: Post translational modification, Ubiquitin, Phosphoribosylation, SdeA, signaling protein
Deposited on 2016-10-31, released 2016-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5m93a_
  • Chain 'B':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG47 (3-End)
      • expression tag (0-2)
      • conflict (4)
    Domains in SCOPe 2.07: d5m93b1, d5m93b2
  • Chain 'C':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG47 (3-End)
      • expression tag (0-2)
      • conflict (4)
    Domains in SCOPe 2.07: d5m93c1, d5m93c2
  • Heterogens: SO4, RIB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5m93A (A:)
    gplgsqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtl
    sdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m93A (A:)
    sqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5m93B (B:)
    gplgsqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtl
    sdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m93B (B:)
    gplgsqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtl
    sdyniqkestlhlvlrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5m93C (C:)
    gplgsqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtl
    sdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m93C (C:)
    gplgsqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtl
    sdyniqkestlhlvlrlr