PDB entry 5m7x

View 5m7x on RCSB PDB site
Description: Translation initiation factor 4E in complex with (RP)-m2(7,2'O)GppSepG mRNA 5' cap analog (beta-Se-ARCA D1)
Class: translation
Keywords: Protein-ligand complex, translation initiation factor, eIF4E, m2(7, 2'O)GppSepG, beta-Se-ARCA, selenophosphate, mRNA 5' cap analog, translation
Deposited on 2016-10-28, released 2017-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eukaryotic translation initiation factor 4e
    Species: Mus musculus [TaxId:10090]
    Gene: eif4e
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5m7xa_
  • Chain 'B':
    Compound: eukaryotic translation initiation factor 4e
    Species: Mus musculus [TaxId:10090]
    Gene: eif4e
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5m7xb_
  • Chain 'C':
    Compound: eukaryotic translation initiation factor 4e
    Species: Mus musculus [TaxId:10090]
    Gene: eif4e
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5m7xc_
  • Chain 'D':
    Compound: eukaryotic translation initiation factor 4e
    Species: Mus musculus [TaxId:10090]
    Gene: eif4e
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5m7xd_
  • Heterogens: RSE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5m7xA (A:)
    vanpehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmp
    gcdyslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysd
    dvcgavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatks
    gsttknrfvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m7xA (A:)
    npehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgc
    dyslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddv
    cgavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtaknrfv
    v
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5m7xB (B:)
    vanpehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmp
    gcdyslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysd
    dvcgavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatks
    gsttknrfvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m7xB (B:)
    npehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgc
    dyslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddv
    cgavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatknrf
    vv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5m7xC (C:)
    vanpehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmp
    gcdyslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysd
    dvcgavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatks
    gsttknrfvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m7xC (C:)
    pehyikhplqnrwalwffknktwqanlrliskfdtvedfwalynhiqlssnlmpgcdysl
    fkdgiepmwedeknrwlitlnkqqrrsdldrfwletllcligesfddysddvcgavvnvr
    akgdkiaiwttenrdavthigrvykerlglpknrfvv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5m7xD (D:)
    vanpehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmp
    gcdyslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysd
    dvcgavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatks
    gsttknrfvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m7xD (D:)
    pehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcd
    yslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvc
    gavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqsknrfvv