PDB entry 5m7q

View 5m7q on RCSB PDB site
Description: Engineering the Thermostability of Nanobodies - NbD2
Class: immune system
Keywords: Nanobody, VHH, variable domain, Camelids, immune system
Deposited on 2016-10-28, released 2016-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-09, with a file datestamp of 2016-11-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nanobody NbD2
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 5M7Q (0-End)
    Domains in SCOPe 2.07: d5m7qa1, d5m7qa2
  • Chain 'B':
    Compound: Nanobody NbD2
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 5M7Q (0-End)
    Domains in SCOPe 2.07: d5m7qb1, d5m7qb2
  • Heterogens: SO4, CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5m7qA (A:)
    qvqlqesgggsvqaggslrlscavsentgrmgwfrqapgkerekvaiitrlggytsyagp
    vkgrftisqdnakntvyllmnslkpedtaiyycaadsrpiysgtwrywgqgtqvtvssaa
    aypydvpdygshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m7qA (A:)
    qvqlqesgggsvqaggslrlscavsentgrmgwfrqapgkerekvaiitrlggytsyagp
    vkgrftisqdnakntvyllmnslkpedtaiyycaadsrpiysgtwrywgqgtqvtvssaa
    aypydvpdygs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5m7qB (B:)
    qvqlqesgggsvqaggslrlscavsentgrmgwfrqapgkerekvaiitrlggytsyagp
    vkgrftisqdnakntvyllmnslkpedtaiyycaadsrpiysgtwrywgqgtqvtvssaa
    aypydvpdygshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m7qB (B:)
    qvqlqesgggsvqaggslrlscavsentgrmgwfrqapgkerekvaiitrlggytsyagp
    vkgrftisqdnakntvyllmnslkpedtaiyycaadsrpiysgtwrywgqgtqvtvssa