PDB entry 5m4r

View 5m4r on RCSB PDB site
Description: Structural tuning of CD81LEL (space group C2)
Class: cell adhesion
Keywords: human cellular receptor for Hepatitis C virus, CELL ADHESION
Deposited on 2016-10-19, released 2016-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CD81 antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: CD81, TAPA1, TSPAN28
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5m4ra_
  • Chain 'B':
    Compound: CD81 antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: CD81, TAPA1, TSPAN28
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5m4rb_
  • Chain 'C':
    Compound: CD81 antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: CD81, TAPA1, TSPAN28
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5m4rc_
  • Chain 'D':
    Compound: CD81 antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: CD81, TAPA1, TSPAN28
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5m4rd_
  • Chain 'E':
    Compound: CD81 antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: CD81, TAPA1, TSPAN28
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60033 (Start-91)
      • expression tag (92-93)
    Domains in SCOPe 2.07: d5m4re1, d5m4re2
  • Heterogens: SO4, EDO

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5m4rA (A:)
    etgfvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsv
    lknnlcpsgsniisnlfkedchqkiddlfsgkgtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m4rA (A:)
    nkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlknnl
    cpsgsniisnlfkedchqkiddlfsg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5m4rB (B:)
    etgfvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsv
    lknnlcpsgsniisnlfkedchqkiddlfsgkgtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m4rB (B:)
    vnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlknn
    lcpsgsniisnlfkedchqkiddlfsg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5m4rC (C:)
    etgfvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsv
    lknnlcpsgsniisnlfkedchqkiddlfsgkgtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m4rC (C:)
    vnkdqiakdvkqfydqalqqavvddannakavvktfhetldccgsstltalttsvlknnl
    cpsgsniisnlfkedchqkiddlfsg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5m4rD (D:)
    etgfvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsv
    lknnlcpsgsniisnlfkedchqkiddlfsgkgtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m4rD (D:)
    vnkdqiakdvkqfydqalqqavvddnnakavvktfhetldccgsstltalttsvlknnlc
    psgsniisnlfkedchqkiddlfsgk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5m4rE (E:)
    etgfvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsv
    lknnlcpsgsniisnlfkedchqkiddlfsgkgtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m4rE (E:)
    vnkdqiakdvkqfydqalqqavvddnakavvktfhetldccgsstltalttsvlknnlcp
    sgsniisnlfkedchqkiddlfsgkgt