PDB entry 5m4e

View 5m4e on RCSB PDB site
Description: Application of Off-Rate Screening in the Identification of Novel Pan-Isoform Inhibitors of Pyruvate Dehydrogenase Kinase
Class: transferase
Keywords: Off-Rate Screening, PDHK, HSP90, SPR, kinase inhibitors, fragment screening, cancer, PDK1, PDK2, PDK3, PDK4, transferase
Deposited on 2016-10-18, released 2017-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-05, with a file datestamp of 2017-03-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5m4ea_
  • Heterogens: 7F9, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5m4eA (A:)
    mghhhhhhhhhhssghiddadkhmdqpmeeeevetfafqaeiaqlmsliintfysnkeif
    lrelisnssdaldkiryesltdpskldsgkelhinlipnkqdrtltivdtgigmtkadli
    nnlgtiaksgtkafmealqagadismigqfgvgfysaylvaekvtvitkhnddeqyawes
    saggsftvrtdtgepmgrgtkvilhlkedqteyleerrikeivkkhsqfigypitlfvek
    erdkevsddeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5m4eA (A:)
    evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
    lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
    vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
    eyleerrikeivkkhsqfigypitlfve